KEGG   Gekko japonicus: 107115417Help
Entry
107115417         CDS       T04299                                 

Definition
(RefSeq) cytosolic beta-glucosidase-like
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
gja  Gekko japonicus
Pathway
gja00500  Starch and sucrose metabolism
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107115417
Enzymes [BR:gja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     107115417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 107115417
NCBI-ProteinID: XP_015272604
Position
Un
AA seq 494 aa AA seqDB search
MASTPSTTLATPAYCNWNLEDASFPEQFAWGASTSAYQIEGGWDADGKGPSIWDTFAHQA
GERVFENQTGDVTCSSYTLWEEDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFVNQKGVDY
YNTVIDSLLANKVTPMVTLYHFDLPQCLEDRGGWRSGATVEAFDAYAHFCFRTFGDRVKL
WLTINEPYVIAELGYETGIMAPGIKEPGTGAYLSAHNMIKAHAAAWHTYDEVFRKQQGGL
VSIALNSDWAEPFHPNSPADQEAAKRHIGFCLDWFATPIFMNGDYPVVMKSKISAMSKKQ
GYPSSRLPEFTPEEKMTIKGTADFFALNYYTTRKIKHQDYACGQPSSTGDKEAEQVTDPS
WPVATGSSWLAVVPWGLRHLLKYIKDTYNHPIIYITENGFSQSDPAPLDDSRRWEYFRLT
LQEILKAIYIDDVRVAGYFVWSLLDNFEWTCGYSSRFGLFHVDFENAALPRVPYTSAIEY
TKVIANNRLMNLHG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaactccctccacgactctggcaacccctgcttactgcaactggaatctggaa
gatgcttccttcccggaacaattcgcctggggtgcctcgacctcagcctatcagattgaa
ggaggctgggatgcagacggaaaaggccccagcatttgggacacgttcgcccaccaggcg
ggagagcgggtcttcgagaaccagactggcgacgtcacttgcagcagctacactctgtgg
gaggaagatttgaaatgtatcaaacagcttggcttgactcattatcgcttctctctttcc
tggtcacgtctgttacctgatgggacgacaggtttcgtcaaccagaaaggagtcgattat
tataacacagtgattgacagcctgctagctaacaaagtgacgcccatggttacattgtat
cactttgacttgccgcagtgtttagaagatcggggcggctggagatcaggtgcaaccgtg
gaagcctttgacgcgtacgcccacttttgcttccggacctttggggacagagtgaagcta
tggctcaccataaacgaaccgtatgtcatcgcagagcttggctatgaaacaggcattatg
gccccgggtattaaggaacctggtactggagcctacctgtccgctcacaacatgatcaaa
gctcacgctgcggcctggcacacttacgacgaagtgttccggaaacagcagggtggactt
gtgtctatagcactcaactcggactgggcggagccctttcaccccaattcccccgccgac
caggaagcagctaagaggcatatcggattttgcctggattggtttgctaccccgatcttt
atgaatggtgactatccagtcgtcatgaaatccaagatctctgctatgagtaaaaagcaa
gggtatccgtcgtcaaggcttccagagtttaccccggaagagaagatgacaatcaaaggc
actgctgatttctttgctctgaattattatacgacccgcaaaattaagcaccaggattat
gcgtgtggtcagccaagtagtactggagacaaagaagcagagcaagtaacagatccatcg
tggcctgttgcaactgggagctcttggctggctgttgttccgtggggtttgcggcacctg
ttgaaatacatcaaggatacatataatcatcctataatttacatcactgaaaatgggttt
tcccaaagtgaccccgctccacttgatgactctcgacgctgggagtactttaggctgact
ctacaggagattttaaaagccatttacatcgacgatgtccgagtggcaggctattttgtg
tggtccctactagacaactttgaatggacttgcggatacagctctcgatttggactcttc
catgtggattttgaaaacgcagctctccctcgagttccttacacatcagcaattgaatac
accaaagtaattgccaacaaccgactgatgaatttgcacgggtga

DBGET integrated database retrieval system