KEGG   Gekko japonicus: 107116053Help
Entry
107116053         CDS       T04299                                 

Gene name
VPS41
Definition
(RefSeq) VPS41, HOPS complex subunit
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107116053 (VPS41)
Membrane trafficking [BR:gja04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    107116053 (VPS41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Vps39_2 Vps39_1 ANAPC4_WD40 zf-RING_2 zf-rbx1 zf-RING_11
Motif
Other DBs
NCBI-GeneID: 107116053
NCBI-ProteinID: XP_015273395
Position
Un
AA seq 841 aa AA seqDB search
MAEAEKEPKSNEESTDESEEDDSEAEPKLKYERLSNGVTEILQKDVASCMTVHEKFLALG
THYGKVYLLDVQGNITQKFDISPVKINQVSLDESGEHMGVCSEDGKVQVFGLYTGEEFHE
TFDCPIKIVAVHPQFVRSHYKQFVTGGNKLLLYEKTWMSRWKPSILHEGEGTIRNVKWKG
NLIAWANNMGVKILDVITKQRITNVPRDDISLRPDMYPCSLCWKDNLTLIIGWGNSVKIC
YVKERHASEMRDLPSRYVEIVSQFNTEFHISGVAPLCDQLVVLSYVKEVLEKTETEYCAR
PRLDIIQPFPESCEEISSDALTVREYSEGESLFYIISPRDVVVAKERDQDDHIEWLLEKK
KYEEALMAAEISQKTMKKHKIQDIGLGYIEHLLKIGEYDLAARKCQKILGKNTDLWEFEV
HRFKEIGQLKAISRYLPRHDSILKPFIYEMVLHEFLESDYEGFATLIKEWPGNLYNNTII
VQAVVDRLKKDPQNTTLLKTLAELYTYDQRYGKALEIYLTLRHKDVFQLIHKHNLFSSIR
DKIVLLMDFDSEKAVDMLLDNEDKISIDKVVEELTNRPELQHVYLHKLFKRDHHKGQNFH
EKQISLYAEYDRPNLLPFLRDSTHCPLEKALEICQQRNFVEETVYLLSRMGNSRSALKMI
MEELNDVDKAIEFAKEQDDAELWEDLILYSIDKPPFITGLLNNIGTHVDPILLIHRIKEG
MEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQKRGVLVDEESICEA
CLPPILPTSASEAFRVTVFHCRHLFHKECIPEPNTNSSVKFCNICSAKHRGPGSAILEMK
K
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcagagaaggagcccaagagtaatgaagaatctacagatgagtctgaagag
gatgacagtgaagcagagcccaagctgaagtatgaaaggctttctaatggggttacagaa
attctccaaaaggatgtagccagttgcatgacagttcacgagaagtttttggcacttggg
acacattatggcaaggtttatttacttgatgtccaggggaacatcacccaaaagttcgat
attagcccagtgaagatcaatcaagtcagcctggatgaaagtggagaacacatgggcgtc
tgctcggaagatggcaaggtgcaggtgtttggattatacacgggagaagaattccatgaa
acattcgattgcccaattaaaattgttgccgttcaccctcagtttgtgaggtcgcattac
aaacaatttgtaacaggaggaaacaagttgctgttatatgaaaagacctggatgagcaga
tggaagccttccattttacatgaaggagagggaactataaggaatgtcaagtggaaagga
aacctaattgcttgggccaataatatgggtgtgaagatactcgacgtgatcacgaagcaa
agaatcaccaacgtgccccgagacgatataagcctccgtcctgatatgtatccttgcagc
ctttgctggaaagataatttaacactgattattggctggggaaattcagtaaagatctgc
tacgtaaaagaacgacacgccagcgaaatgcgagatctgccgagtcgttacgtggaaata
gtttcccagttcaacaccgaatttcacatcagtggagttgcacctctctgtgaccagctt
gttgtgctttcctacgtaaaggaggttttggagaaaacagaaactgagtactgtgccaga
cctcggctggatataattcagccgtttcccgagtcctgtgaagaaatttcttctgatgca
ctaacagtccgagaatattcagaaggggaatcgcttttttacatcatcagtccgagagat
gtcgtcgtggccaaagaacgtgatcaagacgaccacattgagtggctcctagagaaaaag
aaatatgaagaggctttgatggcagctgagatcagtcagaagaccatgaagaaacacaag
attcaagacataggcttaggctatatagaacacctcctgaaaattggagaatatgatctt
gcagcacgaaaatgccagaaaattcttggaaaaaacacagatctctgggagtttgaagtg
catagatttaaagaaattggacaacttaaggccatcagccgctatttgccaagacacgat
tccatcttgaagcctttcatttatgaaatggtcctacatgaattcctagagagcgactat
gagggcttcgcaacactaataaaggaatggcctggaaatctctacaacaacacaataatt
gtccaggcagtagtcgatcgcttgaagaaagaccctcagaacacgactttattgaagaca
cttgccgagttgtacacctatgaccaacgctatggaaaggcccttgaaatttacctcaca
ctgagacataaagatgttttccagctgatccacaaacacaatcttttcagctccatcagg
gacaaaattgttctgctaatggactttgattcagagaaagcagtcgacatgctgttggat
aatgaagataaaatctctattgacaaagttgtagaagaactgacaaacaggcctgaactg
caacatgtgtacttgcataaactcttcaagagggaccaccacaaagggcaaaatttccac
gagaaacagatcagcctctatgctgagtatgaccggccaaacttacttccttttctccga
gacagcacccactgcccattagaaaaggctcttgaaatctgccagcaaagaaactttgta
gaagaaacagtatatcttttgagcagaatgggcaacagccggagtgccctgaagatgata
atggaggagctgaatgatgtcgataaggcaattgaatttgccaaggagcaagacgatgcg
gaactttgggaagacctcatcttgtattccattgacaaaccacctttcatcactggcttg
ttaaataacattgggacacacgtcgatcctatcctcctgatccatcgtataaaagaagga
atggagattccaaatttaagagactccctggtcaaaattctccaggattacaatttacag
atcttgcttcgggagggatgcaagaagatccttgttgccgactcactgtccttgctgaaa
aagatgcaccgcacgcaaaagagaggggtccttgtggatgaggagagtatctgtgaggca
tgtcttcccccaatactgcctacaagtgcatccgaagccttccgagtcactgtgtttcac
tgcaggcatctgttccacaaagagtgcattcctgaacctaacacaaactcttcagtgaag
ttctgtaacatctgcagcgctaagcaccgaggcccaggcagcgccatcctggagatgaaa
aaatga

DBGET integrated database retrieval system