KEGG   Gekko japonicus: 107117014Help
Entry
107117014         CDS       T04299                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate-CoA ligase alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
gja  Gekko japonicus
Pathway
gja00020  Citrate cycle (TCA cycle)
gja00640  Propanoate metabolism
gja01100  Metabolic pathways
gja01200  Carbon metabolism
Module
gja_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gja_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107117014 (SUCLG1)
   00640 Propanoate metabolism
    107117014 (SUCLG1)
Enzymes [BR:gja01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     107117014 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     107117014 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 Glyco_tran_WecB
Motif
Other DBs
NCBI-GeneID: 107117014
NCBI-ProteinID: XP_015274532
Position
Un
AA seq 334 aa AA seqDB search
MGCKKHKMKWSFLLSFFSLLVQKNGVRHCSYAATRKNLYITKDTKVICQGFTGKQGTFHS
QQALEYGTNLVGGISPGKGGKTHLGLPVFNSVKEAKGQTGATASAIYVPPPFAAAAIIEA
IDAEIPLVVCITEGIPQQDMVRVKHRLLRQNKTRLVGPNCPGVINPGECKIGIMPGHIHK
KGRIGIVSRSGTLTYEAVHQTTQAGLGQSFCVGIGGDPFNGTNFIDCLEVYLKDPNTAGI
ILIGEIGGNAEEDAAEFLKQNNSGPESKPVVSFIAGITAPPGRRMGHAGAIIAGGKGGAK
EKIAALQNAGVVVSMSPAQLGSTMYKEFEKRKML
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcaagaagcacaaaatgaaatggtcattccttctttcctttttttctcttcta
gtgcagaaaaatggagtacggcattgttcttatgcagcgacgcggaaaaacctgtacatc
actaaagacaccaaggtcatttgtcaaggttttactggcaaacagggtacctttcacagt
cagcaagcgctggaatacggcaccaacctagtgggaggcatttctccaggcaaagggggc
aaaactcacctggggcttcccgtctttaactcggtgaaggaggcaaaaggacaaacgggc
gcgactgcctctgcgatatacgtgcctcctccgtttgctgctgctgccatcattgaagcc
atcgatgccgaaatccccttggtggtctgcatcaccgaagggataccccagcaggacatg
gttcgggttaagcaccgactgcttcgccagaacaagacgcggctcgtcggcccaaactgt
ccgggagttatcaaccccggtgaatgtaaaatcggcatcatgcccggccacattcacaag
aaaggcagaatcggtatcgtatccagatctggcacgctaacgtatgaagccgttcatcag
acaactcaagcaggactgggacaatcgttttgtgtgggaatcgggggagacccgttcaac
gggacaaatttcattgactgcctggaggtctacctgaaagaccccaatactgccgggatt
attctgataggcgagattggtggaaacgccgaagaagatgctgctgaattcctgaaacaa
aacaactccggtccagaatccaagccggtcgtctctttcattgcggggatcaccgctcct
cccggcaggaggatgggtcacgccggagccatcattgccggcgggaaagggggagcgaaa
gagaagatcgccgccctccagaacgccggcgtcgtcgtcagtatgtctcctgctcagctc
ggctccactatgtacaaggagttcgagaagaggaaaatgctataa

DBGET integrated database retrieval system