KEGG   Gekko japonicus: 107117114Help
Entry
107117114         CDS       T04299                                 

Gene name
CACNA1I
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107117114 (CACNA1I)
   04020 Calcium signaling pathway
    107117114 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gja04040]
    107117114 (CACNA1I)
Ion channels [BR:gja04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107117114 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 107117114
NCBI-ProteinID: XP_015274652
Position
Un
AA seq 2181 aa AA seqDB search
MAEQGSHPSSAWHSGNPSAHNPTLCPLERVDLGITEQLTPLEQPPPSPDLGDDDEDDDVE
PLPDPDVPYPDLAPVVFFCLKQTTSPRNWCIKMVCNPWFECVSMMVILLNCVTLGMYQPC
DDMDCLSNRCKILQVFDDFIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGM
VEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFI
FGIIGVQLWAGLLRNRCFMDENLTIQGNITLPPYYQPEEDDEMPFICSLSGDNGIMGCHE
IPPLKERGHECCLDKDDYFYYISVRQEFNVSGMCVNWNQYYNECRTGNSNPHKGAINFDN
IGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFS
ETKQREHQLMQEQRARYLSSSTVASYMEPGDCYEEIFQYVCHIVRKAKRRTLGFYNSLQD
RRLGQTEPSTAKRSISGKDQRQYRRCRKHNSVDYMPQNLGQPIAMTLTSDPSNCPSCHKT
QREATRRLSVLDSADSDQEEGGEASEDEGDGRKGSEGVADLEKEEEDGEEGGQRTHCSYI
WQEVRVKLRGIVESKYFNRGIMIAILVNTISMGIEHHEQPEELTNILEICNVVFTSMFAL
EMILKLSAFGLFDYLRNPYNIFDSIIVIISIWEIIGQADGGLSVLRTFRLLRVLKLVRFM
PALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFD
SLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGF
QAEGDANRSYSDEDQSSSNIEEFDKCQDSLDPKLCAVPMTPNGHLDPSIPCLNQPGAVVG
IANPSRHTLQPDQVLVALESRKSSVMSLSSCRSSHYGAWGRSGGWGSRRSSWNSLARGHS
LKHKPPSAEHESLLSGERHRISEGEREGLVRVRHHRRTLSLDTKGSSELVELAPAVPSGH
RPTRRIGVTTGPIEHQDCNGKMPTITKDIFPEMNNRKDHGEDEEEIDYSLCFRIKKMIEA
YKPDWCELREDWSIYLFSPQNRFRILCQTIIAHKLFDYIVLAFIFLNCITIALERPQIEQ
RSTERIFLTVSNYIFTAIFVAEMTLKVVSLGLYFGDQAYLRSSWNILDGFLVLVSIIDIV
VSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAF
FIIFGILGVQLFKGKFYHCLGVDIRNITNRSDCMAANYKWVHHKYNFDNLGQALMSLFVL
ASKDGWVNIMYNGLDAVAVDQQPVTNNNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHK
CRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCSVRLLIHSVCTSHYLDIFITFI
ICLNVVTMSLEHYNQPMSLETALKYCNYMFTAVFVLEAVLKLVAFGLRRFFKDRWNQLDL
AIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQAL
PQVGNLGLLFMLLFFIYAALGVELFGKLVCNDEHPCEGMSRHATFENFGMAFLTLFQVST
GDNWNGIMKDTLRDCTQDDRSCLSNLQFISPLYFVSFVLTAQFVLINVVVAVLMKHLDDS
NKEAQEDAEMDAEIELEMAHGLCPRSSSSPSSGQDGGGGRVDPEGHLCMTCYSPAQENLW
LDSVSLIIKDSFDGELMIIDNLSGSVFHHYSSPAMCEKCNHDKQEVQLAEMEGLSLNSDK
SSILLGDDGDNHSVDQLSPKETQDGLDSPSSLGMGDLEECLLPLANSEASPAPESYLCET
EETPFSPVQSWLKNESNQGPSTPFSPDIPNPLLTVPAEFLHPVVSADRPGQEKASCPENL
PKISLQASWASRQSPNVNCSLIRQTTESDTSLDDSRSNSSEGSLQTTLEDSLNLSDSPQC
TLDLPVALCPVPATATQRALVAPLSPASRRQSLRGRGIFTLRNIRRHQRSHSSGGSTSPG
CTYHDSMDPSDEEGAGSSLRGGGNNSEQSETLSSLSLTSLFSPPPPPQGLTLVKKCNSTS
SLHANPSSRGSAATEAKQFYSVDPRGFLSMPSWVTDFCKNSPSPREGKVPDLGSDKLGTV
DSSSPVPPELELGNGVSKRNR
NT seq 6546 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacagggctcccacccctcctctgcctggcattcggggaatccatctgctcac
aaccccactctgtgccctctggaacgtgtggatctgggaattactgagcaactgaccccc
ttggagcagccaccaccatccccagatctgggcgatgacgacgaagatgacgacgttgag
cctctaccagacccagacgtaccataccctgatttggctcctgtggttttcttctgctta
aaacagaccaccagtcctcggaactggtgcatcaagatggtgtgcaatccttggtttgag
tgtgtcagcatgatggtgatcctgttgaactgtgtgacccttgggatgtaccagccctgt
gacgatatggactgcctttccaacagatgtaaaattttgcaggtatttgatgacttcatt
ttcatcttctttgctatggagatggtgctgaagatggtggccttgggtatctttggcaag
aaatgctaccttggagacacctggaaccgcctggatttcttcattgtcatggctgggatg
gtggaatattctctggacctccaaaacattaatttgtctgcaatccgcactgttcgcgtc
ctgaggcccctcaaagccatcaaccgtgtgcctagcatgcggatcctggtaaatttgcta
ctggacaccttgcccatgctggggaatgttctgcttctctgcttctttgtcttcttcatc
ttcggcatcattggagtgcagttgtgggctgggctgctgagaaaccgctgcttcatggat
gagaacttaacaatacaaggtaacatcacccttcctccctactatcaacctgaggaggat
gatgaaatgcccttcatctgttcactgtccggagataatggtatcatgggatgccatgag
attcccccattgaaggagcggggccatgaatgctgtttggacaaggatgactatttctac
tacatctctgtgaggcaggagtttaacgtcagcggcatgtgtgtcaactggaaccagtat
tacaatgagtgccgcacaggcaattccaatccacataaaggggctatcaactttgacaat
attggctatgcatggattgttatatttcaggtgatcacactggaagggtgggtggagatt
atgtactatgtgatggatgctcattcattctataacttcatctacttcatcctgctgatc
attgtgggctcattcttcatgatcaacctgtgcctagtggtcattgccacacaattttca
gagactaaacagcgagagcaccagctgatgcaggagcagagggcacggtacctgtcctcc
agcactgtcgccagctacatggaaccaggagactgctatgaggagatcttccagtatgtc
tgccatattgtgcgcaaagccaagcgccgcacccttggcttctacaacagcctgcaggat
cgacgcctaggccaaacagagccaagcactgccaagcggagcataagtgggaaagatcag
aggcaatacaggcgttgccggaaacacaattctgtagattacatgccacaaaatcttggt
cagcctattgccatgacattgacctctgaccccagcaactgtccaagctgtcacaagacc
cagcgggaagcaacccgaagactttctgtactggacagtgctgattcggatcaggaggaa
ggaggagaagccagtgaggatgagggagatggaaggaaaggaagtgagggggttgcagac
ctggagaaggaagaggaagatggagaagaaggcggacaacggacacactgcagctacata
tggcaagaagtgagggtcaagttgaggggaattgtggagagcaaatacttcaaccgtggg
atcatgatcgccatccttgtgaacaccatcagcatgggtattgagcatcatgaacagcca
gaggaactaaccaatattttggagatctgcaatgtggtatttaccagcatgtttgccctg
gagatgatcttgaaactttctgcctttgggctctttgattatctccgcaacccttacaac
atctttgacagcatcatcgtcattatcagtatctgggagatcatcggccaggcagatgga
ggcctgtcagtgctgaggacattccggctgctgagggtgctgaagctggtgagattcatg
cccgccttgcggcgtcagctagtggtgctaatgaagaccatggacaatgtggctaccttc
tgcatgctcctcatgttgtttatcttcatattcagcatcctaggaatgcacatctttgga
tgtaaattcagcctcagaactgacacaggagacacggttcctgacagaaagaattttgac
tctctgctttgggctatcgtcactgtgttccagatactcactcaggaggactggaatgtt
gttctctataatggcatggcctcaacttccccttgggcatccctgtattttgtggctctc
atgacatttggcaattatgttctcttcaatctgctggtggccatcctagtggagggattc
caggctgagggtgatgctaatcggtcgtattcagacgaggatcagagttcatcaaacata
gaggagtttgacaagtgccaggacagtttggacccaaagctctgtgcagttcctatgacc
ccaaatggacatcttgaccccagcattccttgtctcaaccagcctggggcagttgttgga
attgctaacccttcccgccatactctgcagccagaccaagtccttgttgctcttgaatcc
aggaaaagcagtgtgatgtctctgtctagttgtcgtagttcccactatggagcatggggc
cggagtgggggctgggggagccggcgctccagctggaacagccttgcgcggggacacagt
ctcaaacacaagcctccttcagctgagcatgagtcactgttatctggagaaaggcacagg
atttccgagggagaaagagaagggctggtaagagttcgacaccatcgacggacactctcc
ctagacaccaaaggctcctctgaactggttgagttggcaccagctgtcccatccggtcac
aggccaacacggagaataggtgtaacaacagggcctattgagcatcaggactgcaatggt
aaaatgcccactatcacaaaggacatcttcccagaaatgaacaatcgcaaggaccatgga
gaagatgaggaggagatagactatagcctgtgtttccgcataaaaaagatgatcgaggcc
tacaagccagactggtgtgaattgcgggaggactggtctatctacctcttctcaccgcaa
aacaggttccgcatcctctgccaaactatcattgctcataagctttttgattacatcgtc
ctggccttcatcttcctgaattgcatcactattgccctggagagacctcagattgaacag
aggagcacagagagaatcttccttacagtatccaattacatcttcacagcaatctttgtc
gctgaaatgactctgaaggtagtctcccttggcctatattttggggaccaggcctatctc
cggagcagttggaatattctggatggcttcttggttctcgtatctatcattgacatagtc
gtttcagtggcttctgctggtggagccaaaattctgggggtactacgagttctccggcta
ctgcgcactttacgccccctcagggtcataagccgtgccccaggcctcaaactggttgtt
gagacactcatttcgtccctcaagcccatcgggaacattgtcctcatttgctgtgctttc
ttcatcatttttggcattcttggggtgcagctctttaaggggaagttctaccattgcctg
ggtgtggatatccgaaacatcaccaacaggtcggactgcatggccgccaattacaagtgg
gtacatcacaaatacaacttcgacaatctgggccaggctttgatgtctctgtttgtgctg
gcttccaaagacggctgggtcaatattatgtacaatggactggatgctgttgctgttgac
cagcagcctgtgaccaacaacaacccttggatgctgctctacttcatttctttcttgctc
atcgtcagcttcttcgtgctcaacatgtttgtaggagtggtggtagagaacttccacaaa
tgtagacagcatcaagaggcagaggaggcccgccgacgggaggagaaacgcctgaggcgc
ctggagaagaagcgtaggaaagcacagcgcttgccgtattatgccacctactgctctgtc
cgccttctcattcattcggtctgcaccagccactacttggacatcttcatcaccttcatc
atttgcctcaacgtcgtcaccatgtccctggagcactacaaccagccaatgtctctggag
acggccctcaagtactgcaactacatgttcactgcagtctttgtgctggaggccgtcctg
aagcttgtggccttcgggctgaggcgcttcttcaaagacaggtggaaccaactggacctg
gctattgttctgctctcagtcatgggcatcacacttgaagagatcgaaatcaatgccgcc
cttcccatcaaccccaccatcatccgtatcatgagagtcctgcgcatcgcccgagtcttg
aagctattgaagatggcgactgggatgcgggctttgctggacacagttgtgcaagcacta
ccacaggtggggaaccttggattgctcttcatgctcctttttttcatctatgctgctctc
ggagtggagctctttggaaagcttgtatgtaatgatgagcacccctgtgagggcatgagt
cgccatgccacctttgagaactttgggatggctttcctcacgcttttccaggtctccact
ggtgacaactggaatggaattatgaaggacactcttcgggactgcacccaggacgaccgg
agttgtctcagcaacttgcagttcatctcgccactctacttcgtcagttttgtgctcaca
gcccagtttgtcctcatcaatgtagtagtagctgtactcatgaagcacttagatgacagc
aacaaggaagcacaggaggatgccgaaatggatgctgagattgagcttgagatggctcat
gggctgtgcccacgtagctctagctcgccaagctctggacaagatggaggcggtgggaga
gtggaccctgaaggacacctgtgcatgacatgttactctcctgcacaggagaacttatgg
ctggacagtgtctctttaattattaaggactccttcgacggggagttaatgatcatcgat
aacctatcgggctccgtcttccatcattactcctcgccggccatgtgcgagaagtgtaac
catgacaagcaagaggtccagttggctgaaatggaaggcttatcgctcaactctgataag
tcttcaatcctgctaggggatgatggagacaaccacagcgtggatcagctgagccctaag
gaaactcaggatggtctggacagtcccagctccctggggatgggagatttggaggagtgt
ctcctccctttggcaaactcagaagcttctccagctccagaaagttacttatgtgaaaca
gaagaaactcctttcagtccagtccagtcttggctgaagaatgagagcaaccaaggtcct
tccacccctttctctccagatatacccaatcctctgttaacagttccagcagagtttttg
catccagttgtctctgccgatcggccaggtcaggagaaagcttcctgcccagagaatctc
cctaaaatctctctgcaagcttcctgggcatcacggcaatctccgaatgtgaactgctca
cttatccgccagaccactgagagtgacacttccttggatgacagcaggagcaacagctca
gagggcagcctgcagaccacactggaggacagcttaaacctcagtgattcgccccagtgc
accctggacctcccagtagcactgtgcccagtgccagccaccgccacccaaagagctctg
gtggcaccactttcccctgcctctcgaaggcagagcttgaggggccgagggatttttact
ctacggaacatcaggcggcaccaacggagccacagcagtggtgggagcaccagccccggt
tgcacctaccatgactccatggacccttctgatgaggagggtgctgggagcagcttgagg
ggaggaggcaacaacagtgagcagtcagagaccctcagcagtctctctctgacttctctc
ttctccccaccccctccaccccaaggtctgacactcgtaaagaagtgcaacagcaccagc
agtcttcacgccaacccttcttcccggggttctgcagcaactgaagccaagcaattctac
tcggttgacccaaggggttttttatccatgccttcatgggtgacggacttctgcaagaac
agcccttctccaagggagggcaaggtaccagacctgggctcagacaaacttgggactgtg
gattccagctccccagttccacctgagttggagctgggcaatggagtcagcaagaggaac
agatga

DBGET integrated database retrieval system