KEGG   Gekko japonicus: 107117943Help
Entry
107117943         CDS       T04299                                 

Gene name
NT5C2
Definition
(RefSeq) 5'-nucleotidase, cytosolic II
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
gja  Gekko japonicus
Pathway
gja00230  Purine metabolism
gja00240  Pyrimidine metabolism
gja00760  Nicotinate and nicotinamide metabolism
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107117943 (NT5C2)
   00240 Pyrimidine metabolism
    107117943 (NT5C2)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    107117943 (NT5C2)
Enzymes [BR:gja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     107117943 (NT5C2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid
Motif
Other DBs
NCBI-GeneID: 107117943
NCBI-ProteinID: XP_015275622
Position
Un
AA seq 560 aa AA seqDB search
MTTSWSDRLQNAADLPANMDGHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVY
KSPEYESLGFDLTVERLVSIGYPQELLSFVYDPAFPTRGLVFDSLYGNLLKVDAYGNILV
CAHGFNFMRGPEIREQYPNKFIQRDDTDRFYILNTLFNLPETYLLACLIDFFTNCDRYAS
CETGFKDGDLFMSFRSMFQDVRDAVDWVHYKGSLKEKTVENLAKYVVKDGKLPLLLSRMN
EVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGT
VLRQVDTVTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKS
KKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQ
RRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAA
HVLMPHESTVEHTHVDINETESPMATRNRTSVDFKESDKRHQLTRSVSEIKPPNLFPQAP
QEITHCHDEDDDEEEEEEEE
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttcatggagtgatcgattacaaaacgcagcagatcttcctgcaaatatggat
gggcatgctctgaagaagtaccgtcgggaagcatatcaccgggtttttgtgaacagaagt
ctagccatggaaaaaataaagtgctttggatttgatatggattatacattagctgtgtac
aagtctccagaatatgaatcccttgggtttgacctgacagttgagcgattagtttcaatt
ggatatcctcaagagctgctcagttttgtctatgatcctgcattcccaaccagaggcctg
gtgtttgattccctttatggaaacctgttaaaagttgatgcctatgggaacatcttggta
tgcgcacatggctttaacttcatgagagggccagagatccgagagcagtatcctaataaa
ttcatccagagggatgacactgacaggttttatattctaaacactctgttcaacctacca
gaaacctacttgttggcttgtctgatagatttttttactaactgtgacagatatgcaagc
tgtgaaacagggtttaaagatggagacctcttcatgtccttcaggagcatgttccaggat
gtgagagatgctgtggactgggtacattataagggatctctcaaggagaagacagttgag
aatctggcaaagtatgtggtgaaagatggaaagctgcctctgctgttgagccgtatgaat
gaggtgggaaaagtgttccttgcaaccaacagtgattataaatacactgataaaataatg
acttacctgtttgattttccacatggaccaaagcctggcagctctcatcggccatggcaa
tcatactttgacctcatccttgtggatgcacgcaagcctctcttttttggtgaagggaca
gtcttgagacaggtggacacggttactggcaagttgaagattggtacctacacaggtccc
ctacagcatggcattgtctactctgggggttcctctgataccatctgtgatcttttgggg
gccaaaggcaaagacattttatacattggagatcacatctttggagatattctgaagtcc
aaaaaacgtcagggttggaggactttcttagtaattccagaactggcacaggagcttcat
gtctggacagacaaaagctccctttttgaagaacttcagagtctagacatcttcttagca
gagctatacaaacatttggatagtagcagcaatgaacgccctgacatcagttccatccag
aggcgtataaagaaagtgactcatgatatggacatgtgctatggaatgatgggaagcctg
ttccgaagtggctcccgacagacactgtttgccagtcaagtgatgcgctacgcagacctt
tatgcagcatctttcatcaacctcctatactaccccttcagttacctcttcagagctgcc
catgtactgatgcctcatgagtcaactgtggagcacactcatgtggatatcaatgagaca
gaatcaccaatggccacacgcaaccgcacttcagtggatttcaaagagtctgacaaacga
caccagttgacccgatctgttagtgagatcaaacctcctaatctcttccctcaagctccc
caggagatcacacattgccatgatgaggatgatgatgaagaggaggaggaggaggaggaa
tag

DBGET integrated database retrieval system