KEGG   Gekko japonicus: 107118306Help
Entry
107118306         CDS       T04299                                 

Gene name
ABHD12B
Definition
(RefSeq) abhydrolase domain containing 12B
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gja01002]
    107118306 (ABHD12B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107118306 (ABHD12B)
Enzymes [BR:gja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107118306 (ABHD12B)
Peptidases [BR:gja01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   107118306 (ABHD12B)
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107118306 (ABHD12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase VirJ LIDHydrolase DUF1749 Lipase_3 FSH1 Epiglycanin_C Cutinase
Motif
Other DBs
NCBI-GeneID: 107118306
NCBI-ProteinID: XP_015276097
Position
Un
AA seq 398 aa AA seqDB search
MKRRSERGGEAAARPDGSQGKGLGGAAAGALQPAAGGLLAYLQKFKIKRLLLDLFILYAS
VPFVIRLFPSLLRKFVYLNFLSYPFGVDFQKPEVYLNHTVNFYLTPEPGVTYGVWHSLPD
SRRKEAEGKDPSWHEEALADDNPVILYLHGNGGNRAMSHRVRMAKVMSDADFHVLAIDYR
GYGDSTGDPSETGFTTDVLFLYHWVKARSGNSTVIVWGHSLGTGIATNVARALKEKEGVT
VDAVILEAPFTNIREAAATIPVTKIYRKFPGFEYLILDTMARADMYFYSDRNVQVLSSPI
LMLHSEDDGIIPITHSRKLFEIARNTSQKKDAIRFLSFPASEGYGHDHLSSNPELPDIVK
ARTKNRHETEDDRSPPWDLQFLSFRSPLHTGRVRWVYG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcggagcgagcggggaggagaggcggctgcgcggccggacggctcccagggc
aaaggcctcggcggcgccgccgccggggcgctccagccggcagccgggggactcctggcc
taccttcagaaatttaagatcaagaggctcctgctggacttgtttattttgtacgcttct
gtccccttcgtcattcggctctttccttcgctcctccggaagtttgtctatctcaatttt
ttgtcttacccctttggagtggacttccagaagcccgaagtgtacctcaatcacacagtc
aacttctatcttactcccgagccaggggtcacctatggcgtttggcattccctgcccgac
agcaggcggaaggaggcggaaggcaaggaccccagctggcacgaagaagccctggccgac
gataatcccgtcatcctctatctccacggcaacggggggaacagggcgatgagccacaga
gtgcgtatggcaaaggtgatgagtgatgccgactttcatgtgctggccatcgactacaga
ggctatggagactccaccggggaccctagtgagacgggcttcacgacagacgtcctgttc
ctctatcactgggtgaaggcccggagcggaaacagcacggtcatcgtctgggggcactcc
ctcggcaccggaattgctacaaacgttgccagggcgctgaaagagaaagaaggggtcaca
gtggatgcagtaatcctagaggcacctttcaccaacatccgtgaggcagcggccacgatc
cccgtgacaaaaatctaccgcaagtttcctggcttcgagtatttaatcttggacacgatg
gcgcgcgccgacatgtacttctacagcgacagaaatgtccaagtgctgtccagcccgatc
ttaatgttgcattcagaagacgacggcatcatacccatcacccacagcagaaagcttttc
gagatcgcccgcaacacctcacagaagaaagatgccatccgcttcctttccttccctgcc
agcgagggctacggacacgatcatctttcctccaaccccgagctcccagacatcgtgaag
gcacggaccaagaacagacatgaaacagaggacgatcgctcacccccttgggacttacag
ttcctgagtttccgatctcccctgcacacggggagagtcagatgggtgtatgggtaa

DBGET integrated database retrieval system