KEGG   Gekko japonicus: 107119605Help
Entry
107119605         CDS       T04299                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gja01002]
    107119605
Enzymes [BR:gja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107119605
Peptidases [BR:gja01002]
 Serine Peptidases
  Family S33
   107119605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase DUF1057 DUF1100 Lipase FSH1 Esterase
Motif
Other DBs
NCBI-GeneID: 107119605
NCBI-ProteinID: XP_015277611
Position
Un
AA seq 335 aa AA seqDB search
MELTAVKILFMVFGSILACITSILVARYNLWHKILFKIWTWIRRMKRGVKVKYAKHNGYN
FCYFTRGKPGSQPSMLMLHGFSLTKDMWLDTLKYIPKDIHVVCVDLPGHGATTRLMGDSY
TAPDQAKRVHEFVKTIGMDKKPFHLIGFSMGGMIAGVYAALYPSHVRCLSLLCPGGIRYQ
GGYEFIKHLREVEKSVSVGSPRLVSLTEGQGEELLKLGLYHPSIAQLQLLKGYLEDDRPQ
RMFFIKNFLDLSSEESRYSLQENASKIKAPTEILWGTYDKILNPCGADILAKAIPHCQVF
ILDRCGHFITIDRPQKSAELILEFHISVCGTKKTN
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggagctcactgcagtcaagatactcttcatggtttttggctccattttggcttgcatc
acaagtattcttgtcgcaaggtacaacctgtggcataaaatactgttcaagatctggaca
tggatcaggcgcatgaaacggggcgtgaaggtgaagtacgccaaacacaatggctacaac
ttctgttatttcacccgagggaagcctggatcccagccatccatgctgatgcttcatggg
ttctcactcaccaaagacatgtggttagatacccttaagtatattcctaaggacatccac
gtggtctgtgttgaccttccaggtcatggggcaaccactcgcttgatgggagatagttac
acagcacctgatcaggctaagcgggtacatgagtttgtcaagacaattggtatggacaaa
aaaccctttcacctgattggcttctccatgggtggaatgatagctggggtttacgctgct
ctttatccatcgcatgtccgctgcttgtccctcctttgcccaggtggaatccggtatcaa
ggaggttatgagttcattaagcacttgagagaggtggagaagtccgtcagtgtgggaagc
cctcgcctcgtttctttgactgaggggcagggagaagagctcctgaagcttggcttatac
cacccaagcatagcacagttgcagctccttaagggatatcttgaggatgacagaccacaa
aggatgttcttcattaagaactttttagatctctccagtgaggagtccaggtacagcctt
caggagaacgcaagcaagatcaaggctccaaccgagatcctctggggaacgtatgacaag
atacttaatccctgtggagcagacattttagccaaagccattcctcactgccaagtgttc
atattggaccgatgtggacatttcataaccatagacaggccacagaaatctgcagaactc
atcctggaattccacatttcagtctgtggcacaaagaagactaactag

DBGET integrated database retrieval system