KEGG   Gekko japonicus: 107119606Help
Entry
107119606         CDS       T04299                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
gja  Gekko japonicus
Brite
Enzymes [BR:gja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107119606
Peptidases [BR:gja01002]
 Serine Peptidases
  Family S33
   107119606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase DUF1100 DUF2048 DUF1057 FSH1
Motif
Other DBs
NCBI-GeneID: 107119606
NCBI-ProteinID: XP_015277612
Position
Un
AA seq 336 aa AA seqDB search
MESSTITILWLAASCAVIALSLTFSTLYYWRPARIVTLLIWSMLKLRHVKVKYFKHEGYK
FCYFSRGKPGPQPSILMFHGFSLAKDMWLPIMKYIPKDVHVVCVDLPGHGGTSRLPGEGY
TAIEQAKRMHQFVEYSGLNRKPFHLVGISMGGMVAGVYAALYPSDIHCLSLLCPAGLRYP
TDNDFVKCLKEMEKRKDFRDIPLIPVTLNQSEELFKLSLYHCPRKPNKQLMQGFLDLRKP
HVPFYTKCFLDISSVESRHSLHDNISKLTVPTQVIWGKHDKVLDPAGGEIFADAMPSCQV
HMLDRCGHFIIVDRPRKCTKLILDFRALTCGIKKNK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggagagcagtacgatcacgatactctggctggctgcaagctgtgccgtgattgccttg
tcacttactttttccacactgtactactggaggcctgcacgaatagtcacgctcctgata
tggtccatgcttaaactcagacatgtgaaagtaaaatatttcaagcatgagggctacaag
ttctgttacttcagccgtgggaaaccaggaccccagccatctatactgatgtttcatggg
ttctcgcttgccaaagacatgtggttacctataatgaaatatattcctaaggatgtccac
gtggtctgtgtggacctgcctgggcacgggggaacatctcgcttgccaggagaaggctac
acagccatcgagcaggctaagcggatgcaccagtttgttgagtactctggtctgaacagg
aagcctttccacctggtcggcatctccatgggtggaatggttgctggcgtttatgccgct
ctttatccatcggatatccactgtttgtccctcctttgtccagctggtctaagatatcca
acagataatgactttgtgaagtgtttgaaggagatggagaaacgcaaggatttcagagac
atcccactcattcctgtgactctaaaccagtcagaagaactgttcaaactttccctctac
cattgcccacggaagccaaacaaacagctcatgcagggatttcttgaccttcggaaacca
catgttcctttttacactaaatgttttttagatatctccagtgtggagtccaggcacagc
cttcatgacaacataagcaagctaacagttccaacacaggttatctgggggaaacacgac
aaggtgcttgacccagcaggtggagaaatttttgccgacgccatgcctagctgccaagtg
catatgctggacagatgtggacattttattatagtagacagaccaaggaaatgcacaaag
ctgattttggacttccgtgctttgacttgtggcataaagaagaataagtag

DBGET integrated database retrieval system