KEGG   Gekko japonicus: 107119840Help
Entry
107119840         CDS       T04299                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
gja  Gekko japonicus
Pathway
gja00564  Glycerophospholipid metabolism
gja00565  Ether lipid metabolism
gja00590  Arachidonic acid metabolism
gja00591  Linoleic acid metabolism
gja00592  alpha-Linolenic acid metabolism
gja01100  Metabolic pathways
gja04010  MAPK signaling pathway
gja04217  Necroptosis
gja04270  Vascular smooth muscle contraction
gja04370  VEGF signaling pathway
gja04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107119840
   00565 Ether lipid metabolism
    107119840
   00590 Arachidonic acid metabolism
    107119840
   00591 Linoleic acid metabolism
    107119840
   00592 alpha-Linolenic acid metabolism
    107119840
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107119840
   04370 VEGF signaling pathway
    107119840
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107119840
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107119840
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107119840
Enzymes [BR:gja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107119840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2 ICAT
Motif
Other DBs
NCBI-GeneID: 107119840
NCBI-ProteinID: XP_015277940
Position
Un
AA seq 804 aa AA seqDB search
MRNVHQQDHLSETDCYVTLWLPTASSEKVRTKTVANSKDPVWNETFYFRIQSQVKNVLEL
AVCDEDIIRDDTYRVIHFDIAEVPLGESVFKTFELNPQKHEELEIEFTLENIMDPPEMIT
TNGAIVCRELCCLEIQVDQRKRKKKKKLSKQQVVKCTLKGSFEETQNLSLCCKSCSHCTD
PTIFHYAKFKQAELEVLLPKKRPLPCFGACMSCGSNVQRNRNLTFPLNSFPFDQDVINDD
TEFDLHFKAKQCTAGLDVRLGFELCPEEQEFLQKRKKVAAAALKRVLHLEEDLQDDEVPI
VAIMTTGGGIRALTSMYAHMQTIQKLDILDCVSYLTGLSATTWTMSKLYDDANWSKNNLE
KLITDAKGHVKKNKFLASFAPERLKYYLKELKQRHQEGYSVSFTDLWGLIIEAMLRDGEN
PHKLTDQQQALTHGQNPLPVYLCLSVKEKLSNRGFREWLEFTPYEVGFQKYGAYIHPEHF
GSEFFMGHLIKKIPESRICFLEGIWSSVFSVNIMDGWFLSVSSDDFWQKWTQDRITDIDD
YVLYSHVNKLPTLMESPPDSLATIFQDIIMWRPAVTQVHNFLKGCPMHNKYLESQLAVWK
DCDLDNFPNQLTGAEDHLYLVDNAFAFASSYPPLMRPERKVDVIIHLNYSSGSQMMPLKE
ASKYFSEQGIPFPQNIPHEEKDVKECYLTGDQESPETPIVVLFALVNDTFKEYKAPGVKR
SPEEMEDGRLDLTSTFGPYNINALRYSEEDFDKLVKLSQYNIMNNKDLIIKALQLAVERK
KQHKNSLQCRTDEAFQSGRKGNKI
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaatgtccaccaacaagaccatttaagtgaaactgattgctatgtaaccttgtgg
ctgcctactgcctcatctgaaaaggttcgaactaaaacagttgccaactccaaagatcca
gtgtggaatgaaacattctacttcaggatccagagtcaggttaagaatgtcttggaactg
gctgtgtgtgatgaagacattattcgagatgatacgtaccgtgtcatccattttgacatt
gctgaagtgcctcttggagagtcagtttttaagacatttgaattgaatccacagaaacat
gaggaactggagattgaatttacactggagaatataatggatcctcccgaaatgatcaca
acaaatggagcaatagtgtgtcgtgaactttgctgcttggagattcaggtggaccaaagg
aaaaggaagaagaagaaaaagctttctaaacaacaagttgtcaagtgtacattgaaagga
tcctttgaagaaacccaaaacctttccttgtgctgtaaatcctgctctcactgcacagat
cccaccatcttccactatgccaaattcaagcaagcagagctggaggttctgctccccaag
aagaggccacttccttgctttggtgcttgcatgtcatgtggatcaaatgtgcagaggaac
agaaatctgacctttcctttaaattcatttccctttgatcaggatgtaataaatgatgac
acggaatttgatttacacttcaaagcaaagcaatgcactgcaggcctagacgttcgcttg
ggttttgaactctgtcctgaagagcaggaattcctgcaaaaacggaagaaagttgctgct
gcagctttgaaaagagttcttcatctagaggaagatctgcaagatgatgaggtaccaatt
gtggcaattatgactactggtggagggataagagccctgacatcaatgtatgctcatatg
cagactatccagaagttggatattttggactgtgtttcatacctcactggcttatctgcc
acaacctggacaatgtcaaagttatatgatgatgctaactggtcaaagaataatctagag
aagctaatcactgatgcaaaagggcatgtgaaaaaaaacaagttccttgccagttttgcc
ccagagcgtctgaaatattatctaaaggaactaaagcagcggcatcaagaaggctacagt
gtatctttcactgatctgtgggggctcatcattgaagccatgctacgtgatggggaaaat
ccacataaactcacagatcagcagcaagcattaactcatggccaaaaccccctgcctgta
tacctttgtctcagtgtgaaggagaaattaagtaatcggggtttcagagaatggttggag
ttcacgccatatgaggttggattccaaaaatatggagcctacattcatcctgaacatttt
ggtagtgaatttttcatgggtcatttaattaaaaaaatcccagaatctcgaatctgcttc
ttggaaggaatctggagtagtgtgttttcagttaatatcatggacggctggtttctgtct
gttagttcggatgatttttggcaaaagtggacacaagaccgaataactgatattgatgac
tatgttttgtattcacatgtgaataaactacctactcttatggagagccccccagatagt
cttgctactatttttcaagatattatcatgtggcgaccagcagttacccaggtccacaat
tttttgaaaggctgcccaatgcacaacaagtacctggagagtcagcttgcagtgtggaaa
gactgtgatctggacaattttcctaaccagctgacaggagctgaagatcacctgtatcta
gttgataatgcatttgcctttgctagcagctatccaccactcatgaggcctgagaggaaa
gtggatgtcatcatacatttgaattacagctcaggatcacaaatgatgcccctgaaagaa
gcctcaaagtatttctcagaacagggaatcccatttccccaaaatatcccacatgaagaa
aaggatgtaaaggagtgttacctgactggagatcaagaaagccccgaaactcctatagtg
gtcctttttgccttagttaatgacactttcaaagagtacaaagcaccaggtgtgaaacgt
agtcctgaggagatggaagatggtagacttgatcttactagtacctttggcccttacaat
ataaatgctttacgatattcagaggaagactttgacaagctggtaaaactgagtcagtac
aacataatgaataacaaagatttgattattaaagccttgcagctcgcagtggaacggaaa
aagcaacataaaaacagtctgcagtgtagaacagatgaagcatttcaatctggaaggaaa
gggaacaaaatctaa

DBGET integrated database retrieval system