KEGG   Gekko japonicus: 107120017Help
Entry
107120017         CDS       T04299                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
gja  Gekko japonicus
Pathway
gja00010  Glycolysis / Gluconeogenesis
gja00562  Inositol phosphate metabolism
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107120017 (MINPP1)
   00562 Inositol phosphate metabolism
    107120017 (MINPP1)
Enzymes [BR:gja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107120017 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107120017 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Rrn6
Motif
Other DBs
NCBI-GeneID: 107120017
NCBI-ProteinID: XP_015278143
Position
Un
AA seq 478 aa AA seqDB search
MLPGSMSRCAGCFRWRLLCLVALLAEGEGQESAAGRLSPYFGTKSRYETANPHLLREPLS
LGPPQPGFPLPAASCTPLRLHAVIRHGTRFPTRGQIKKLARLHSLVGQRNGSCPASLALD
WWAMWYREEMDGLLAERGRHDMSLLARRLAARFPGLLAPQRRFVFISSHKSRCVNSSEAF
RDGLYRALHGQQQQQQQQAPTLESNPAMLGDIKINDTLMRFFDLCEKFVRDVENNKEAMH
ELDDFKTGPEMKEVIERVADKLCLQADQLNADLVQVAFFTCSFELAIKNISSPWCLLFSR
ENALVLEYLNDLKQYWKRGYGYEINSRASCILFQDIITNLDQAVAESKNSKPISSPAILQ
FGHAETLQPLLALMGYFKDNEPLKANNYHKHMNRKFRSGRIVPYAANLVFVLYHCDQVQS
PKEEYKVQILLNEKLLEFPWSKKTVISFANLKNRYKDVLQKCHFTDVCDLPQNSTACA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgctccccggctccatgtcgcgctgcgcgggatgctttcggtggcggctgctgtgcctg
gtggcgctcctggcggaaggggaaggccaggagtcggcggcggggcggctgagcccctac
ttcggcaccaaatcccgctacgagaccgccaacccgcacctcctgcgggagccgctgtcg
ctggggccgccgcagccgggcttccccttgccggcggcctcctgcacgccgctgcggctc
cacgccgtcatccgccacggcacccgcttccccacccgcggccagatcaagaagctggcg
cggctgcacagcctggtcgggcagaggaatggcagctgccccgcctccctggccttggac
tggtgggccatgtggtaccgcgaggagatggacggactgctggccgagcgcgggcgccac
gacatgagcctgctagcccgccgcctggccgcccgcttccccggcctcctggccccgcag
cgccgcttcgtcttcatctccagccacaagtcccggtgcgtgaacagcagcgaagccttc
agggacggcctgtatcgggcgctccacgggcagcagcagcagcagcagcagcaggcgccc
acgctggaaagcaatccggctatgctgggagacattaaaattaatgacacattaatgaga
ttttttgacctgtgcgaaaaatttgtaagagacgtggaaaacaataaggaagctatgcat
gaactggatgacttcaaaacaggtcctgagatgaaggaagtgatagagagagttgcggat
aaattatgtctacaagcggatcagttaaatgcagatttggttcaggtggcatttttcacg
tgctcgtttgagctagctatcaaaaacatcagcagcccctggtgtttactgtttagtaga
gaaaatgccctggtacttgaatatctgaatgatctaaagcaatactggaagagaggatac
ggatatgagataaacagtcgtgccagctgcattcttttccaggatatcatcacaaatttg
gaccaggctgtagcagagagtaaaaattcaaagcctatttcttcacctgcaatcctccag
tttggtcatgcagagacccttcaaccactccttgctctcatgggttacttcaaggacaac
gagcctcttaaagcaaataactaccataagcatatgaatcggaaatttcgtagtggccga
atcgtcccttatgctgcaaacctggttttcgtgctttaccattgtgatcaagtccagtct
cccaaggaagagtacaaagtacagatcctgctcaatgagaaactgctggaatttccttgg
tcaaagaagacggtcatttcatttgccaacctgaaaaaccgctataaagatgtccttcag
aaatgccacttcacagacgtgtgtgacttgccgcagaacagtactgcttgtgcttga

DBGET integrated database retrieval system