KEGG   Gekko japonicus: 107120453Help
Entry
107120453         CDS       T04299                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 1
  KO
K05197  glutamate receptor 1
Organism
gja  Gekko japonicus
Pathway
gja04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107120453 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gja04040]
    107120453 (GRIA1)
Ion channels [BR:gja04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107120453 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF659 DUF2061
Motif
Other DBs
NCBI-GeneID: 107120453
NCBI-ProteinID: XP_015278642
Position
Un
AA seq 903 aa AA seqDB search
MQHIFAFFCTSFLGAVLGVNFPSNIQIGGLFPTQQSQEHAAFMSALSQFTEPPKLSPQID
IVNISDSFEMTYTFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHLCFITPSFPVDTSNQ
FVLQLRPELQDALISVIEYHKCQKFMYIYDADRGLSVLQKVLDTAAEKNWQVTAVNVMTT
TEEDYKSLFQNLEKKKERVVVVDCETDRLNAILNKIVKLGKNGVGYHYILATLGFMDIDL
SKFRNSGANVTGFQLVNETDTIPARIMQQWKNNDAREHPHVDWKGPKYTSALTYDGVRVM
AEAFQSLRKQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGH
RTNYTLHVMEMKPDKNRKIGYWNEDEKFVPTAVDQQGANETTNLQNRTYIVTTILEAPYV
MHKKSYEQLEGNERYEGYCVELAAEIAKHVGYQYRLQIVSDGKYGARDPESKLWNGMVGE
LVYGNADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHNEELEEGRDQPANDQTNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIS
YGTLDAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVPTTEEGMKRVRRSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSLLRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRASAAGTSSGENGRVVSHDFPKTMQEIPCMGHSSGMSLGA
TGL
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccagtttcctaggggcagtgttgggggtcaat
ttccccagcaacatccagatagggggattatttcctactcaacaatcccaggaacatgcg
gcttttatgtctgcactgtctcagttcacagagccccccaagctgtctccccagattgac
attgtgaatattagtgacagctttgaaatgacctacaccttctgttcacagttctccaag
ggtgtctatgctatttttggcttttatgagagaaggactgtcaacatgctcacatccttt
tgtggggctctccacctctgtttcataacgcccagcttccctgtcgacacttccaaccaa
tttgttcttcagctgcgccctgaactgcaggacgccctcatcagtgttatagaatatcac
aagtgccagaaatttatgtacatttatgatgctgaccggggtttgtcagtccttcaaaaa
gtgttggatacagctgcagagaaaaactggcaggtgacagctgtcaatgtcatgacaaca
acagaagaggattacaagtcactcttccaaaatctggagaagaagaaggagcgggtagta
gtggtggactgtgaaacagaccgactgaatgctatcttgaacaagatcgttaagcttgga
aaaaatggggtaggatatcactacattcttgcaacactgggtttcatggatattgaccta
tcaaaattcaggaacagtggagcaaatgtgactggattccagctggtaaatgagacagac
actattccagccaggatcatgcaacagtggaagaacaatgatgccagggaacatcctcat
gttgactggaaggggccaaagtacacatctgcccttacatatgatggagtcagggtaatg
gcagaagctttccagagtctcaggaaacaacgaattgacatctcccgtcgagggaatgct
ggagattgtcttgcaaatccagctgttccttggggacaaggaattgacattcagagagct
ctacagcaggtgcgctttgaaggattgacgggtaatgttcagtttaatgagaaaggacat
cggacaaattacacccttcacgtgatggaaatgaaacctgataagaataggaagattggt
tattggaatgaagatgaaaaatttgtcccaacagccgtagatcaacaaggagcaaatgaa
accactaatctccaaaataggacctacatagtcacaacaattctagaagccccatatgtg
atgcataagaagagctatgagcagttggaaggaaatgaaaggtatgaaggatattgcgta
gagttggctgctgagatcgcaaaacatgttggctaccaatacaggttgcaaattgttagc
gacgggaagtatggagcccgagatcctgagtctaaattatggaatggcatggtcggggag
ttagtatatggaaatgctgatgtagctgttgcaccattgactatcacgcttgtgcgagag
gaagttatagacttttccaaaccatttatgagcctgggcatctctatcatgattaaaaaa
cctcaaaagtccaagccgggggtcttttcctttctggatccactagcttatgagatttgg
atgtgcattgtttttgcctacattggagtgagtgttgtcctttttctggtcagtcgcttc
agcccttatgagtggcacaatgaggagctggaagaaggacgtgaccagccagccaatgac
caaacaaacgaatttgggatatttaacagtctctggttctccttgggagcttttatgcaa
caagggtgtgatatatctccaagatccctgtctggacgtattgttggtggagtctggtgg
tttttcaccttgatcatcatttcttcttacacagccaatttagctgcattcttgaccgtg
gagaggatggtgtctcctatagaaagtgcagaagatttggccaagcaaacagagattagt
tatggaactctggatgctggttctactaaagaattttttaggagatctaaaatagcggtt
tttgagaagatgtggacgtacatgaagtcagctgagccctctgttttcgtgccgacaaca
gaagaggggatgaaacgtgtgaggagatcgaaagggaagtatgcctacctgctagagtct
accatgaatgagtacattgagcagagaaagccatgtgacaccatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcaaccccaaaaggttcactactaagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggagtgtggaagcaaagactccggaagtaaggacaaaacaagtgct
ttgagcctcagcaatgtggccggtgttttctacatcctcatcggtgggcttggactagca
atgctggttgccttaatcgagttttgttacaagtccagaagtgaatcaaaacggatgaag
ggtttttgtttgatcccacagcaatctatcaatgaagccatacggacatcaactcttcct
cgagcatctgcagcaggaaccagcagtggagaaaacggacgggtggtgagccacgatttc
cctaaaaccatgcaggagattccgtgcatgggtcacagctctgggatgtccctgggagca
acgggattataa

DBGET integrated database retrieval system