KEGG   Gekko japonicus: 107120669Help
Entry
107120669         CDS       T04299                                 

Gene name
HNMT
Definition
(RefSeq) histamine N-methyltransferase
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
gja  Gekko japonicus
Pathway
gja00340  Histidine metabolism
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    107120669 (HNMT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107120669 (HNMT)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     107120669 (HNMT)
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107120669 (HNMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12
Motif
Other DBs
NCBI-GeneID: 107120669
NCBI-ProteinID: XP_015278914
Position
Un
AA seq 293 aa AA seqDB search
MTSSMRSLLSDHSRYVESFRLFLENSTEHQCMLEFIEKKLPGIISSIGNGKSAINILSVG
GGAGEIDLQILAKVQAKYPGAFIHNDVIEPSVEQITNYKERVAKTSNLENIKFTWHKETS
LEYESRMKASGNMKMWSFIHMIQMLYYVKDISATIHFFHTLLEPGAKLLIILVSGTSSWS
RLWKKYGPRLPLNDLCLYVSSTDVEEMLNVAGLKYQSYDLPSNMDITDCFTEGNEKGELM
LDFLTETCHFSQTAPLDLKKELVEDLKNLYSENIGGRYFFNNTLSAIVVESSK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacttcttccatgagaagcttgctgtctgaccacagccgttatgtggaatcttttcgc
ctgttcctcgagaattcgacggagcatcagtgtatgctggaattcatcgagaagaagctg
ccaggcataatatcaagtatcggtaatggaaaatctgcaatcaatattcttagcgttggt
ggtggtgcaggagaaattgaccttcagattcttgcaaaagtacaggcgaaatatcccgga
gctttcattcataacgatgtgatagaaccaagtgttgagcaaatcaccaattacaaagaa
cgtgtagcaaagacatcaaaccttgagaacataaagtttacttggcacaaggagacatca
ctggaatacgaaagtcgaatgaaggcgagtggcaatatgaagatgtggagcttcatccat
atgattcagatgctgtattatgtaaaagacatctctgctactattcatttttttcacact
cttttggaacctggggccaaactccttattattcttgtctcaggaaccagcagctggtct
aggttgtggaagaaatatggtcctcgtttacctcttaatgatctttgcttatacgtttca
tccacggatgttgaagagatgcttaatgtggctggactgaagtatcagtcatatgacctt
ccatctaatatggacataacagattgttttactgaaggaaatgaaaagggggagctgatg
cttgattttttgacagaaacttgtcattttagtcaaactgccccacttgacctaaaaaag
gaattggtggaagacctgaaaaatctttacagtgaaaatataggaggaaggtattttttc
aataataccctgagtgcaatagtggttgaatcctcaaaatga

DBGET integrated database retrieval system