KEGG   Gekko japonicus: 107122719Help
Entry
107122719         CDS       T04299                                 

Gene name
HDC
Definition
(RefSeq) histidine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
gja  Gekko japonicus
Pathway
gja00340  Histidine metabolism
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    107122719 (HDC)
Enzymes [BR:gja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     107122719 (HDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 107122719
NCBI-ProteinID: XP_015281340
Position
Un
AA seq 656 aa AA seqDB search
MDQEEYRQRGKEMVDYIFQYLTTLRERRVSPDVKPGYMRGQLPHRAPLESESWDNIFQDI
EKIIMPGVVHWQSPHMHAYFPALTSWPSLLGDMLADAINCLGFTWASSPTCTELEMNVMD
WLAQMLDLPDMFLHYHPDSRGGGILQSTVSESTLVALLAARKNKILEMKTLEPDTDESTL
NSRLVAYASDQAHSSVEKAGLISLVKVRFLPVDENFSLRGETLREAIEKDRSRGLVPFFV
CATLGTTGVCAFDNLEELGPICTKEGLWLHIDAAYAGTAFLCPEFRPFLKGVEHSDSFTF
NPSKWMMVHFDCTAFWVKDKCKLQQTFSVNPIYLRHPNSGSATDFMHWQIPLSRRFRSLK
LWFVIRSFGVKKLQAHVRHGTEMAKYFESLVRSDPLFEIPAKRHLGLVVFRLKGPNWMTE
KVLKDLNKSGSLFLIPAVIQDKFIIRFTVTSQFTTQKDILRDWSLIQRAAVQVFDLCRTP
KPVTSEEVPGAISSPSPKPTGVTSHFFLEKGERRMSSPRRVTAQPRRASLGSAGWLSTEH
ARVPGEPPLEDTFVEDGLNTTSLSNLPAHKKKTRSLSVPTAGLWEPSCSKVASFEGSGKS
AFNTTEKFLSKLPEEVLMLEKSAFKKFLKFYRVPSFPECTVQCGLQLPCCPLQATV
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggatcaagaggaatacagacagagagggaaagaaatggtggattacatttttcagtac
ttgaccacgctgagagagaggcgggtgtctcctgatgtgaagcctggatacatgagaggc
cagctgccccacagagcccccttggagtcggaaagctgggacaacatcttccaggacatt
gagaagatcattatgcctggggttgtccattggcagagtccacacatgcatgcctacttt
ccggctctcacctcgtggccatctttgctgggggacatgctggcagacgcaattaattgc
ctgggattcacttgggcatccagtcccacctgcacagaattggaaatgaacgtgatggat
tggttggctcaaatgttggaccttcctgatatgttcctgcactatcatccagacagcagg
ggtggaggcatattacagagcactgttagcgaatcaactttggttgctctgctggctgca
agaaagaataaaattctagaaatgaaaacactagagccagatacggacgaatcaactcta
aactctcggctcgtcgcttatgcctcagatcaggcccactcttccgtggaaaaagcgggg
ttgatctcccttgtgaaggtgaggtttctgccagttgatgagaatttttccttaagaggt
gaaactctgagagaagccattgagaaggacagaagccgtggcttggtgcctttttttgtt
tgtgccactctgggtacgacaggtgtttgtgctttcgacaaccttgaagagctgggtcca
atatgtactaaagagggcctttggcttcacattgatgctgcgtatgcaggaacggcgttt
ctgtgcccagaattcaggccatttctgaagggagttgagcattctgattctttcactttc
aacccttccaaatggatgatggttcattttgactgcactgccttttgggtcaaggataaa
tgcaagctccagcaaaccttcagtgtcaatcccatctacctcagacatcctaattcggga
tcagctactgatttcatgcactggcaaattcccttgagccgaaggtttcgctcactgaaa
ctctggtttgtgattcgctcctttggtgtgaaaaagctccaagcccacgtcagacacggc
acggagatggccaaatactttgagtcactggtcagaagtgaccccctgtttgagatccct
gccaaaagacacctgggactggttgtgtttcgtttaaagggccctaactggatgacggaa
aaggtcttaaaagatctgaacaagtcgggtagcctcttcctcatcccagcagtgattcaa
gacaagttcatcattcgctttactgtaacgtctcagtttacaacccaaaaggacatcctg
cgagactggagcctcatccaacgtgctgcggtacaagtctttgacctgtgtcgtactcca
aaacctgttacctcagaggaagtccctggcgcgataagcagccccagtcctaaaccaact
ggtgtcacttcccattttttcctggagaaaggtgaacgcaggatgtcatcgccaagacga
gtaacggcacagccacgaagggcatctctcggttctgcagggtggttgtccactgagcat
gctcgagtgcctggggagcctcctttggaagacacttttgtagaggatggcctgaatacc
accagcctctcgaacttgcctgcgcacaagaaaaagacacgctccctcagtgtgccaaca
gcaggcctgtgggagccaagctgttcaaaggtggcaagcttcgagggctctgggaagagt
gcgtttaacaccactgagaaattcctttccaagttgccggaagaggtgctgatgctcgag
aaaagtgccttcaagaaattcttgaaattttaccgtgttcctagtttccccgaatgcact
gttcagtgcggcctccagctgccttgctgccccctgcaagccaccgtctag

DBGET integrated database retrieval system