KEGG   Gekko japonicus: 107122949Help
Entry
107122949         CDS       T04299                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
gja  Gekko japonicus
Pathway
gja00561  Glycerolipid metabolism
gja01100  Metabolic pathways
Module
gja_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    107122949 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gja01002]
    107122949 (MGLL)
Enzymes [BR:gja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107122949 (MGLL)
Peptidases [BR:gja01002]
 Serine Peptidases
  Family S33
   107122949 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Lipase_3 Esterase PGAP1 Abhydrolase_2 Thioesterase DLH Abhydrolase_5 DUF1057 LIDHydrolase TMEM117
Motif
Other DBs
NCBI-GeneID: 107122949
NCBI-ProteinID: XP_015281579
Position
Un
AA seq 311 aa AA seqDB search
MKSGHSSRMPEESSPRKTPQNVPYQDLPHMVNADGQYLFCRYWKPAATPRGLVFVAHGAG
EHCCRYDDLAQMLTGINLFVFAHDHVGHGQSEGDRMVVSDFHVFVRDSLQHIDLMKKDHP
GLPVFLLGHSMGGAIAILTTCERPNDFSGLVLISPLVVANPEVATPIKIFAARVLNLVLP
NLSLGAIDPNVISRNKKEVESYATDPLVHHGGMKVSFVIQLMNAIAKIERSLPKLTLPIL
TLHGSPDKLCDIKGSYLLMDTAPSQDKTLKVYDEAYHALHKELPEVTTSVLKEILTWIGQ
KVSAAEKAPHS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaggtcactcttccagaatgccggaggaaagttccccaaggaagactccccag
aatgtcccgtatcaggaccttcctcatatggttaacgctgatgggcagtacctgttctgc
agatactggaagcctgccgctacgccgaggggactggtatttgtggctcatggtgctgga
gaacactgctgtcgctatgatgatcttgcccagatgttgacgggaatcaatcttttcgtg
tttgcccatgaccatgttggccatgggcagagcgaaggagaccgtatggttgtgtcagac
ttccatgtgtttgtgagagacagcttgcagcacattgacctcatgaagaaggatcaccca
ggcctccctgtgttccttctagggcattccatgggaggagccatcgctatccttaccacg
tgcgaaagaccaaatgacttttcaggcttagtattaatttctcctttagtagttgcaaac
ccagaggtggcaacgccgatcaagatttttgccgctcgagtgcttaacttagtcctgcca
aatctgtccctgggagctatagacccaaacgtgatttcccggaataaaaaagaggttgaa
tcttatgccacagacccactggttcatcatggcggcatgaaagtctcctttgtcatccag
ctgatgaatgccattgccaaaatagaacgctctctccctaaactgacccttcccatcttg
acgctccatggctcgcctgacaaactctgcgatatcaaaggttcctatttgctgatggat
actgctccaagtcaagataaaacactcaaggtgtatgatgaggcctatcacgccctccac
aaagagcttcctgaggtgaccacttctgtccttaaggaaatattaacatggattggtcag
aaagtctcagcagctgaaaaagcccctcactcttaa

DBGET integrated database retrieval system