KEGG   Gekko japonicus: 107123349Help
Entry
107123349         CDS       T04299                                 

Gene name
WNK4
Definition
(RefSeq) WNK lysine deficient protein kinase 4
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107123349 (WNK4)
   01009 Protein phosphatases and associated proteins [BR:gja01009]
    107123349 (WNK4)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107123349 (WNK4)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: Other
  Wnk family
   107123349 (WNK4)
Protein phosphatases and associated proteins [BR:gja01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107123349 (WNK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal Ada3
Motif
Other DBs
NCBI-GeneID: 107123349
NCBI-ProteinID: XP_015282075
Position
Un
AA seq 1222 aa AA seqDB search
MAATAGLCPAGSDRATSPRCHVARTSHRPGRSLLAASPAAMFLCRIAARRSLPLFRRPAD
GHKPPFSSSTNQTMNRYKLESGRLAGGLPERRGLPPERDPRAGAGPEPALGCGPRAECHA
ARPAPRPPSQEEEENEEEAETRAVATSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVA
WCELQTRKLSKVERQRFSEEVEMLKGLQHPNIVRFYDSWKSSVKGQVCIVLVTELMTSGT
LKTYLKRFKEMKLKVLQRWSRQILRGLHFLHTRSPPIIHRDLKCDNVFITGPTGSVKIGD
LGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCMLEMATSEYPYSECQNA
AQIYRKVTSGMKPNSFYKVKVPELKEIIEGCIRMDKRERYTIQDLLDHSFFQEDTGVHVE
LAEEDDGVKSNLKLWLRMDDSKNLHGKYKDNNALEFHFELYKDVAEEVAQEMVMLGFVCE
ADYKLVARAVRERVLAIKRQREKARQAQKRQEKVSTPPPDILHLLELGSSPLLGPAQAST
PTTPGSRDSALGPTFPPEPEEPEVDQHQPFLYRHSYSSATSDCETDGYLSSSGFVDSRDV
PQSLPSPGAAPEPSFTSSIAVSLHPVSTSDFSSPLDSYTSDVASGLSDGYEGLSAGECRV
KPSVKRGPGRLLRRRARPRLRITNISDQNDRVVECQLQTYNNKMVTFKFDLDGDSAEEIA
SVMVAKEFILKSEQDGFIRRIHDIIQRVETFLCKEGESKDQEAAGSPEVQGLSSPLAGGG
FSGQLQGLSRSISSSSSLSGAPSIAAQTWTSRPAVPATPPYLLPVSQPIPPPGALPPPVS
LALPTVPSVGTTGHTPPLPLWTSSPSPSPSLFSLANVFSLAVMSVAQSLLPAVSGVPAQA
GPVYTSPVPQSPGPCPPSQAAAHFIYPETVPPTQPAPLANGLFGPQASPLPSDTSAAESP
DNSLATSSAFLHSGSHLVGSDSPAPTSHLARLFPISEEPKPQILGRFCVTPTRDVPPEIP
PKADGPTSSSASESGSESPGGTPVQEAEEGTTPVAEGEGEGDAHSSTHVWVNYLYSTSYP
SSDDTDSAEDDDVWEELQLLRQKHLSEVEMLQAQQKQEIEELYARLGKVPPPGIVCPAAM
LSSRQRRLSKSSFSLFPRRNSLQRLDMGQPQGIMRRNSVSGGSSSLSQELRQSKGVTFAS
DVGCLIIGCLDVARALLWNLCR
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaactgctggtctctgtcccgcaggctccgaccgcgctacgtcaccacgctgc
cacgtcgcccggaccagtcaccgcccgggtcgctcgctgcttgccgccagccctgccgcc
atgtttctctgccggattgctgctcgccgttcactgccactgttccgccgcccagccgat
gggcacaagccacctttttccagttccacaaaccaaaccatgaaccgatacaaacttgag
agcgggcgcttagcaggggggctgcccgagaggcgcggcctgccgccggagcgggacccc
agggccggggcaggcccggagcccgcgctgggatgtggcccgcgagccgaatgccacgcc
gcccgccccgcgccccggccgccgtcgcaggaggaggaggagaacgaggaggaggccgag
acccgcgccgtggccacctcccccgacggccgcttcctcaagttcgacatcgagatcggg
cgcggctccttcaagaccgtctacaagggcctcgacaccgagaccaccgtcgaggtggcc
tggtgcgagctgcagacacggaagttgtccaaggtggagaggcagcgcttcagtgaggaa
gtggagatgctgaaagggctccagcaccccaacatcgtccgcttctacgactcctggaag
tcctctgtcaaggggcaggtctgcattgtgctggtcacggagctcatgacttcaggcacc
ctcaaaacgtacttgaagcgcttcaaggagatgaagctgaaggttcttcagcgctggagc
aggcagattctgcgggggctccatttcctgcacacccgctcccctccaatcatccaccgt
gacctgaaatgcgacaacgtcttcatcacggggcctactggctctgtaaaaatcggggac
ctcggcttggccacacttaagcgtgcatcgtttgccaagagcgtcatagggaccccagaa
ttcatggcaccagagatgtacgaggagaagtatgacgaagcagtggatgtttacgccttc
ggcatgtgcatgctagagatggcaacatctgagtatccttactcagaatgccagaacgca
gctcagatctatcgcaaggtcacctcgggcatgaagcccaacagtttctacaaagtgaag
gtgcctgagctgaaggagatcatcgagggctgcatccggatggacaagagagagagatac
accatccaggatcttctggatcactccttcttccaggaggacacgggtgtccatgtggaa
ttggctgaagaggatgatggggtgaagtccaacctgaagctttggctgcggatggatgac
tccaaaaatctgcatgggaagtataaggacaacaatgccctggagttccatttcgagctt
tataaggatgtggctgaggaagttgcccaggaaatggtcatgctgggctttgtctgtgag
gcagactacaagctggtggcccgagcggtgcgcgagagggtccttgctatcaagcgccag
cgcgagaaggccaggcaggcgcagaagaggcaggagaaggtgtccacgccccctccggat
atcctgcatctcctggagttgggctcctccccacttctcggccccgcccaggcctccacg
ccgaccacaccgggatcccgggattcagcacttgggccaactttcccaccagagccagaa
gaacccgaggttgaccagcaccagcccttcctgtaccggcacagctattcctctgccacg
tcggactgtgagaccgatggctacctgagttcctctggatttgtggattcgcgcgacgtc
ccgcagagtctccccagcccaggagctgccccagagccctccttcacttcgagcattgcg
gtgagcctgcaccctgtctccaccagtgacttctcttcccccctggacagctacacatca
gatgtggcgtccggcttgagtgacggctatgaaggtctgtctgctggagagtgccgcgtg
aagccttcggtcaagcgcgggcctggaaggctgctgagacggcgtgcccgacctcgcctg
cgcatcacaaatatctcagaccagaatgaccgggtggtcgagtgccaactccagacttac
aataacaagatggtcacctttaagtttgacctggatggggacagtgcagaggagattgcg
tccgtcatggttgccaaggagttcatcctgaaatcagagcaggatgggttcatccgacga
atccacgatataatccaacgtgtggagaccttcctgtgcaaagagggggagagcaaagac
caggaggcggcgggcagcccagaggtgcagggcctctcctctcctctcgctggtggtggc
ttctcgggccagctgcaaggcctttcgcgctccatctcctcatcctcatctctgagcggt
gcccctagcatagctgcacagacctggacctctcgccccgcggtgccagcgactcctccc
tacctgctcccagtgtcccaaccgatccccccaccaggcgccctccctcctcccgtgtcc
ctcgctttacccactgtcccctctgttggcactactgggcacacaccccctctccctctc
tggacctcctctccttccccttcaccatccctgttctctcttgccaatgtcttctcccta
gccgtgatgagtgtggcccagtcgcttctgccagctgtttctggagtccctgcccaggca
ggccctgtctacacctcccctgtcccacagtcaccagggccctgcccacccagccaggct
gctgcccatttcatctacccggagacggtgcctcccactcaaccggccccactggccaat
gggctctttgggccgcaggcgtctccgctgccctccgacacctctgctgcggagagtcct
gacaacagcctggcaacctcttccgccttcctccattccggttcacacctcgttggatcg
gattctcctgcccccacctcccacctcgcccggctcttccccatcagtgaagagcccaag
ccacagatcctgggccgcttctgcgtgacgccaacccgggatgtgccccctgagatccct
ccgaaggccgacgggcccacctcctccagcgcctcagagtcgggcagcgagtctccaggc
gggaccccagtccaggaggcagaggagggcaccacgccggtggcggaaggagagggggaa
ggggatgcccattccagcacccacgtctgggtgaactacctgtacagcacctcctatccg
agcagcgacgatacggacagtgctgaagacgacgacgtctgggaggagctgcagctcttg
cgccagaagcacctgtctgaagtagagatgctccaggcccaacagaagcaagaaattgag
gaactgtatgcccgcctgggcaaggtgccgcctcctggcatcgtgtgcccagccgccatg
ctctccagccgccagcgccgcctctccaaaagcagcttcagcctcttcccgcggcgcaac
agtctgcagcgcctggacatggggcagccccaagggatcatgaggaggaattctgtcagc
ggcgggagcagcagtctctcccaggagctgcggcagagcaagggagtgacctttgccagt
gacgtcggatgcctgatcattggctgcctggatgtggcgcgagccctgctttggaacctg
tgcagatag

DBGET integrated database retrieval system