KEGG   Gekko japonicus: 107123631Help
Entry
107123631         CDS       T04299                                 

Gene name
GMPPA
Definition
(RefSeq) GDP-mannose pyrophosphorylase A
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
gja  Gekko japonicus
Pathway
gja00051  Fructose and mannose metabolism
gja00520  Amino sugar and nucleotide sugar metabolism
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    107123631 (GMPPA)
   00520 Amino sugar and nucleotide sugar metabolism
    107123631 (GMPPA)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     107123631 (GMPPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 DUF4954
Motif
Other DBs
NCBI-GeneID: 107123631
NCBI-ProteinID: XP_015282389
Position
Un
AA seq 437 aa AA seqDB search
MERKILHLDVLFPEITCGRLTAAWTRFRPLSFEVPKPLFPVAGVPMIQHHIEACTKVPNM
KEILLIGFYQPNEALNRFLVSAQQEFKMPIRYLQEYAALGTGGGIYHFRDQILLGNPGAF
FVLNADVCSEFPLEEMLTFHQERGSPDAFLMLGTTANRKQSLNYGCIVANADSHEVLHYV
EKPSTFVSELINCGIYLFTPAIFQHIGAVFQRNQQELLLGSFLGEENANGWQRAEAIRLE
QDVFTALAGQGCLFAFKTEGFWSQIKSAGSAIYANRLYLSCYNQCHPERLAQNHPDGSTI
RGNVYIHPTASVDATAVLGPNVSIGKGVTIGAGVRVRESIILHGASLQDHTCVLNSIVGW
DSTIGRWARVEGTPSDPNPNDPYAKIDSETLFRDGRLTPSITILGCNVTIPAEVVILNSI
VLPHKELSRSFKNQIIL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaaagatcctccacctggatgtcttgtttccggaaataacctgtggaagactg
actgcggcttggacccgcttccgacccttgtcctttgaagtacccaagcccctgtttcct
gtcgcaggggtgcctatgatacagcatcacattgaggcatgcactaaggttcccaacatg
aaggagattctcctgattgggttctatcagcccaatgaagctctcaaccgcttcctggtg
tcggcccagcaagagttcaaaatgcccatccggtatctgcaagaatatgcagcccttggc
acaggaggtggcatctaccacttccgggaccagatcctgttgggtaaccctggggccttt
tttgtgctcaacgccgacgtctgttccgaattccctctagaagagatgctgaccttccac
caggagcgcggcagccccgatgcgttcctcatgttaggcaccacggccaacagaaagcag
tccctgaactatggctgtatcgtggcgaacgctgactcccacgaggtcctgcactatgtg
gagaagcccagcacttttgtcagcgagctcatcaactgtggcatctacttgttcacgcct
gcaatcttccagcacatcggtgcggtcttccagcggaaccagcaggagctgcttctgggt
tcattcctgggagaggagaatgccaacggttggcagcgagctgaggccatcagattggag
caggatgtattcacagcacttgctgggcagggatgcctctttgctttcaaaacagaagga
ttctggagccaaatcaagtctgctggatctgccatctatgccaaccgcctgtacctgagc
tgctacaatcagtgccatccagagagacttgcccagaaccatccagatgggtccactatc
cgagggaatgtctatatccacccaacagcttcagtggatgcaactgctgtgctgggtccc
aatgtctccattggaaaaggggtaacaattggggccggagtgcgtgtgcgtgaatccatc
attctgcatggagcgtctctccaggatcacacctgtgtgcttaacagcattgtgggctgg
gatagcaccattggacgatgggctcgtgtggagggcaccccgagtgaccccaaccctaac
gacccctatgcaaagatagacagtgagacactttttcgagatggccgcctcaccccttcg
atcaccattctgggttgcaatgtgaccatccctgctgaagtggtcatcctgaattctatt
gttcttccccacaaggagctcagtcggagcttcaagaatcaaatcattctctga

DBGET integrated database retrieval system