KEGG   Gekko japonicus: 107123770
Entry
107123770         CDS       T04299                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
gja  Gekko japonicus
Pathway
gja00230  Purine metabolism
gja00240  Pyrimidine metabolism
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107123770 (DCK)
   00240 Pyrimidine metabolism
    107123770 (DCK)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107123770 (DCK)
SSDB
Motif
Pfam: dNK AAA_28 AAA_18 Thymidylate_kin AAA_33
Other DBs
NCBI-GeneID: 107123770
NCBI-ProteinID: XP_015282599
Position
Un
AA seq 256 aa
MATPPKRSRAERIKKIAIEGNIAAGKSTFVNILKQAREEWEVVPEPVARWCNVQTCPDDC
EEELTASQKSGGNLLQMMYEKPERWAFTFQTYACLSRIRAQLKSLDGKLKEAEDPVVFFE
RSVYSDRYIFASNLYESDCMNETEWTIYQDWHNWMNEQFGSSLHLDGIIYLRATPEKCLN
RIYVRGRDEEQGIPIEYLEKLHYKHESWLQHRTLRTDFDYLQEVPVLSLDVNEDFKGNKD
KHENMIEKVKEFLSTL
NT seq 771 nt   +upstreamnt  +downstreamnt
atggcgaccccacccaaacggagccgggccgagagaatcaagaaaatcgccatcgagggc
aacatagctgcagggaagtctacctttgtgaatattctcaaacaagccagagaagagtgg
gaagttgttcctgagcccgtagcaagatggtgcaatgttcagacttgcccagatgattgt
gaggaggagctgacagcctctcagaagagcggaggcaacttgctccagatgatgtacgaa
aagccggagaggtgggccttcactttccagacgtacgcctgcctgagcagaatccgggcg
cagctgaagtctctcgacgggaagctcaaagaggccgaggaccccgtcgttttcttcgag
agatccgtttacagcgacaggtacatctttgcatctaatctctacgagtccgactgcatg
aatgaaacagaatggactatataccaagactggcataactggatgaatgagcagtttgga
tctagtcttcatctggatggtattatttatcttcgagctacccccgagaaatgcttgaac
aggatttacgtgcgtgggagagatgaagaacaaggcatccctatagaatatctggagaaa
cttcactacaaacacgaaagctggcttcagcacaggacgctgcgaacggactttgactac
ctgcaagaggtcccagtcctctcgctggacgtgaacgaagacttcaaaggcaacaaagac
aagcatgaaaatatgatcgaaaaggtcaaagaatttttgagcactttatag

DBGET integrated database retrieval system