KEGG   Gekko japonicus: 107124103
Entry
107124103         CDS       T04299                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gja01009]
    107124103 (AKAP5)
Protein phosphatases and associated proteins [BR:gja01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     107124103 (AKAP5)
SSDB
Motif
Pfam: WSK RhlB
Other DBs
NCBI-GeneID: 107124103
NCBI-ProteinID: XP_015282977
Position
Un
AA seq 496 aa
MEETATEIQREGTQPLEDPKRAKTISPNETPTKKASAFCFKRRKKTCREETDKDEDQGSE
SLNLKSTNHHSSTVLNSETEEQKPSWTSGGAWLAFKRLVTLRRRSKFALKKEVQLGSQVQ
VESSIEDSSLSHLPKEQAGSGLKIPCLRFSRRKKKSGHSERTEELDQGEKTNETTSLLDN
KANSEPESIAVDNPVSSVQSCGRAPEETDRGVEITHGDMIISSGENTLAVEMRPGTDQYT
DCLIQSEIIHSETVLETEQEKQIFQLHHGSLYGSPEEAENKKVDLGVEIDPLISQDLPED
ESRVIEVQGTNHGHTQEVELETSEKNINVGEENKEAKESHSVEVLLHCSPSTLASEALSV
PNCFTEEAKSEENKLPQGVGIVITITEAEEYQDEEETSPACEFFPFSYTSKQKGNKKSGK
GSDSRAGSSGHKREGKTASQVPSPLGVNDQEGRTPEQHELLLIETAASLVKSAIQSSIEQ
LVNEMALEQNKQNSFM
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggaggaaactgctacagaaattcagagggagggtacgcagccattagaagatccaaag
agagcaaaaaccatctccccaaatgagaccccaaccaagaaggcctctgccttttgcttt
aagagaaggaagaagacctgtagggaagaaacggacaaagatgaggaccagggatcggag
tcactaaacttgaagtccacaaaccatcattccagcactgtgttgaacagtgaaacagag
gagcaaaagccatcttggacgtcaggaggagcttggttggccttcaaacgtcttgtgacg
ttgagaaggcggtccaaatttgctctgaaaaaggaagtgcagttaggttcccaggtacaa
gtggagagtagcatcgaagattctagcttgtcgcatttgccgaaggaacaggctggctct
ggacttaaaattccctgcctaaggttctccagaagaaagaaaaagtccggtcattctgaa
aggacagaggagctagaccagggtgagaaaacaaatgaaacaacaagccttttggataat
aaagctaacagtgagcccgagagcatagccgtggacaatccagtgagcagtgtacagtcc
tgtggcagagctcctgaagagactgaccgtggcgttgaaattacccacggagacatgatt
atctcctcaggagagaacactttggcggtggagatgaggccaggaactgatcaatacaca
gattgcctcattcagtcagaaataatccattctgaaaccgtgcttgaaacagagcaggag
aagcaaatcttccagctacatcatggaagcctgtacggaagtcctgaagaagcagagaac
aagaaagtcgacttgggtgttgagatcgaccctctcatttctcaagacctgccagaagat
gaatccagagtcatcgaagtacaaggtaccaatcacggccacacccaggaggttgagctg
gaaacatctgaaaagaacattaatgttggggaggagaataaggaggccaaggaaagccat
tcagtggaggtcctcctccactgtagcccatctacactggccagtgaggctttgagtgtg
ccaaactgtttcactgaggaagcaaaatctgaggaaaataaattacctcagggagtgggc
atagttattactatcactgaagcggaggaataccaggacgaggaggagaccagcccagcc
tgtgaatttttcccgttttcttataccagcaaacagaaagggaacaaaaaatcaggcaaa
ggtagtgattctagggcagggagcagcggtcataagagagaagggaaaacagcctcccag
gttccctcacccttaggggtgaacgatcaggagggccggactcccgaacagcacgagctg
cttctgatcgaaacggccgcttcgctggtcaagtcggccattcagtcgtccatcgaacag
ctcgtgaacgaaatggctttggagcagaataagcaaaacagcttcatgtga

DBGET integrated database retrieval system