KEGG   Gekko japonicus: 107124274Help
Entry
107124274         CDS       T04299                                 

Gene name
RASSF5
Definition
(RefSeq) Ras association domain family member 5
  KO
K08015  Ras association domain-containing protein 5
Organism
gja  Gekko japonicus
Pathway
gja04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gja00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107124274 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA XendoU SPO22 UN_NPL4
Motif
Other DBs
NCBI-GeneID: 107124274
NCBI-ProteinID: XP_015283183
Position
Un
AA seq 266 aa AA seqDB search
MTVDNSMSSGYCSLDEDTDDYFFTARTTLSRNPQSKCAAKNAAKTVEEEKLRAPTIQELK
QKIDNYNSKVNNCLLMKMNDDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDALKEVNVAN
MTEKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKQMQKDGQVLS
QKLSVTEYPLYLRLVAGPDTDVLSFVLKENETGEVEWDAFSIPELQNFLVILEREEKDKI
QQVQNKYNRFKQRLQEALKEANEKPG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcgacaacagcatgagcagtggttattgtagcttggatgaggacaccgatgac
tattttttcacagctaggaccactttgtccaggaatcctcagagcaaatgtgctgcaaag
aatgcagcaaaaacagtggaagaagaaaagctcagagctccaaccatccaagagctgaaa
cagaagattgacaattacaattcaaaagtcaacaactgcttgctgatgaagatgaatgat
gatggcacttacacaggcttcatcaaagtgcacctcaaactgcgccggcctgtgacagtc
ccagcaggcatcaggccgcagtccatctatgatgccctcaaagaggtcaatgtagccaac
atgacagaaaagagaacgtccttctacttgccactggatgccatcaagcagctgcacatc
agcagcactaccactgtcagtgaggtgatccagggacttctgaagaaattcatggtggtg
gacaacccacagaaatttgcacttttcaagcagatgcagaaagatggccaagttctttcc
cagaaactctcggtaacagagtatcctttatacctccgacttgtagccggtcccgacaca
gacgttctcagctttgtgttgaaagaaaatgaaaccggggaagttgagtgggatgccttc
tctattccagagctacaaaacttcctagtaatacttgagagggaagaaaaggacaaaatc
cagcaagtgcaaaacaagtataacaggtttaaacaaagactacaggaggccttgaaagaa
gccaatgagaagcctggataa

DBGET integrated database retrieval system