KEGG   Gekko japonicus: 107124520Help
Entry
107124520         CDS       T04299                                 

Definition
(RefSeq) L-amino-acid oxidase-like
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
gja  Gekko japonicus
Pathway
gja00250  Alanine, aspartate and glutamate metabolism
gja00270  Cysteine and methionine metabolism
gja00280  Valine, leucine and isoleucine degradation
gja00350  Tyrosine metabolism
gja00360  Phenylalanine metabolism
gja00380  Tryptophan metabolism
gja00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gja01100  Metabolic pathways
Module
gja_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107124520
   00270 Cysteine and methionine metabolism
    107124520
   00280 Valine, leucine and isoleucine degradation
    107124520
   00350 Tyrosine metabolism
    107124520
   00360 Phenylalanine metabolism
    107124520
   00380 Tryptophan metabolism
    107124520
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    107124520
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     107124520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox Pyr_redox_2 Thi4 FAD_binding_2 FAD_oxidored AlaDh_PNT_C HI0933_like FAD_binding_3 Pyr_redox_3 MCRA NAD_Gly3P_dh_N Trp_halogenase RWP-RK FMO-like IlvN Lycopene_cycl GIDA NAD_binding_9 DUF1188 ApbA TrkA_N
Motif
Other DBs
NCBI-GeneID: 107124520
NCBI-ProteinID: XP_015283486
Position
Un
AA seq 476 aa AA seqDB search
MECLKDSDYEQLLDIAKKGLKETQEPKTIVIVGAGISGLTAAKLLKDAGHQVMILEASDH
VGGRIKTYREQDWYVDLGPMRLPESHKIVSEYLKKFNLPVSPFDSWDKNAWYLIRNIRRH
TKDKASPGIFGYPVKPDEEGKSAKDLLDKALSKLSKNCALLREKYDSVSTKEYLMKEGNL
SRGAVDMIGDFLNQDAGFYTSFLSLLFVSFSNETRWDEITGGFDQLPRSFFKEMPRIIHF
NSTVEKIVENGTGVTVRFRQPGKSILLGLPADYVLITATAKATRLIKFRPPLSPTKGHAL
RSFHYTSSTKIALACTEKFWEKHGIRGGHSVTDLPSRNIYYPNSNFYSKLGVILASYTLH
DDADFFHALSEEQCIDVVMDDLAEVHNVSKEYLKSVCTKHVIQRWGLDKFSMGAFAYPTP
YQYSHFFNILSKNEGRIYFAGEHTAHPHGWIDTAMKSAIRAASSIHHDTFGSKGHT
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtttaaaagactccgattatgaacagctcttagatattgccaaaaaagggctg
aaagagactcaagagccaaagaccattgtgattgttggagcaggaataagtggactcact
gccgccaaattactaaaagatgctggacatcaggtaatgattctggaagccagcgaccat
gtgggcggccggataaagacctatcgtgagcaagactggtacgtggacttggggcctatg
cgtctgcctgaaagccacaaaatagtttctgaatatctgaagaaattcaatcttcccgta
agcccttttgattcgtgggataagaatgcctggtatttgatcaggaacataagacgacac
acaaaagacaaggccagtcctggcatctttggatacccagtgaagcccgatgaggagggg
aaatctgctaaagatctcctggacaaagcactgagcaagctatcaaaaaactgtgcgctt
ttgagggagaagtatgactcagtttccaccaaggaatacctgatgaaagaaggaaacctg
agcagaggagccgtggatatgattggtgatttcttgaatcaagatgctggcttctataca
tcatttctgagcctcctctttgttagcttttcaaatgaaactaggtgggatgaaatcaca
ggcggatttgaccagcttcccaggagcttcttcaaagaaatgcctaggataattcatttt
aactccacagtagagaaaattgtcgaaaatggcacgggagtaacggtgcggtttcgccag
ccaggcaaatccatcctgttgggtctgcctgccgactacgtcctcatcacagccacagca
aaagccacacggctcatcaaattccgtcctcctctttcccctacgaaaggtcatgctctg
cgttcctttcattatacgagcagcactaaaattgctttggcttgcactgagaaattttgg
gagaagcatgggattcgaggtggccactcagttacagatctcccatcccgaaatatctac
tacccaaacagtaacttctacagtaagctaggagtcatcttggcttcttataccttgcat
gatgacgctgactttttccatgccctcagtgaagagcagtgcattgatgtggtcatggat
gacctagcagaagtccacaatgtgtccaaagaatatctcaaatctgtttgcactaagcat
gtgatacagagatggggtctagacaagttttcaatgggggcatttgcttaccccaccccc
taccagtatagccactttttcaatattttgtctaagaatgaagggaggatttactttgca
ggagaacacacggcccatccccatggctggattgatacagcaatgaaatctgctattagg
gcagccagtagtattcatcatgatacctttggctccaaaggtcatacgtga

DBGET integrated database retrieval system