KEGG   Gekko japonicus: 107125967
Entry
107125967         CDS       T04299                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  ecotropic virus integration site 1 protein
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107125967 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gja03000]
    107125967 (MECOM)
Transcription factors [BR:gja03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    107125967 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-H2C2_5 zf-BED zf-C2H2_11 zf-C2H2_8 PyrI_C
Other DBs
NCBI-GeneID: 107125967
NCBI-ProteinID: XP_015284941
Position
Un
AA seq 1040 aa
MKTEDYSHETMAPDIHEERQYRCEDCDQLFESKAQLVDHQKFPCSTPHSAFSMVEEEFQP
KLDKENDLHDMQDIQECKECDQVFSDVQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHK
HIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFAAGGFFGQGISLPGTPAMDKSSMVNMNHANPGLADYFGTNRHPAGLTFPTAPGF
SFSFPGLFPAGLYHRPPLIPASSPVKGLPSTDQTIKSQSPLMTHPQSLPATQDILKALNK
HPPNLGENKPVELQPERSSEERPHEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIE
SDKEKCKENGKMFKGKVSSLQNLASVNNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIA
SIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRTLPLKMEPQS
PGEVKKITKGNAESPFDLTTKRKEEKPLTPVTSKPATLPVTSQDQPLDLSMGSRSRASGT
KQTEPRKNHIFGGKKGDDLESRKSSDISLQHARPTPFFMDPIYRVEKRKLTDPLEALKEK
YLRPTAGFLFHPHMSAIENMAEKLESFSALKPEASDLIQSVPSMFNFRAPPSTLPENLLR
KGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKE
KPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDSYFTEI
RNFIGNSNHNSSEERMNGSHFKDEKTLVASQNSDLLEDEEAEDEVMMDEEDEESEITGKP
VKEPAASSICEDATEGDYEEENALEMNCKSSPGRYKEEDFNKTGLSALDHIRHFTDSLKV
RKMEESQFSEAELASFGTSHLPEDLKQPLYRKSKSQAYAMMLSLSDKDTLHSASHNSSNM
WHSMARAAAESSAIQSISHV
NT seq 3123 nt   +upstreamnt  +downstreamnt
atgaagactgaagactattcccatgaaacaatggctccagacattcatgaggagcggcag
tatcggtgcgaagactgtgaccagctgtttgagtccaaggcacaactggtggaccatcag
aaattcccatgcagcacacctcactcggcattttctatggtagaagaggaatttcagcca
aagcttgacaaggagaatgatctccatgatatgcaagatatccaagagtgcaaggagtgt
gatcaggtgttctcggatgtacaaagcttagaaaagcacatgctatcccacaccgaagaa
agggagtacaagtgtgaccagtgccccaaagcctttaactggaagtctaacttgatacgc
caccagatgtcacatgacagtgggaagcactatgaatgtgaaaactgtgccaagcaggtt
ttcacggaccccagcaacctccagaggcatatacgttcgcagcacgtcggggctcgtgca
cacgcttgtccagagtgtggcaaaacatttgccacttcttcaggcctcaaacagcacaaa
catatccacagcagtgtcaagccttttatatgtgaggtctgccataaatcctatactcag
ttttcaaacctttgccgtcataagcgtatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggagattttgt
gagggcaagaaccattttgcggcaggaggattttttggccaaggcatatcacttcctgga
accccagctatggataaatcttccatggttaatatgaatcatgcaaatccgggccttgct
gactattttggtaccaataggcatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccctggcctgtttcctgcaggcttgtaccacaggccacctttgatacct
gctagttctcctgttaaaggacttccaagcactgaccaaacaatcaaaagtcaaagtccc
ctcatgacacatcctcagtcactgccagctacccaggatattttgaaggcactaaataag
cacccacctaacctaggtgaaaataagccagtggagcttcaaccagagaggtcctccgaa
gagaggccgcatgaaaaaatcagtgaccaatcagagagtagtgaccttgatgatgtcagt
acccccagtgggagtgacctggagaccacctctggctctgatctggaaagtgacattgaa
agtgataaagagaaatgtaaagaaaatggtaaaatgttcaaaggcaaagtaagcagtctt
cagaatttggcttccgtaaataataagaaagaatacagcaatcattccatcttctcgcca
tctttagaggagcaaactgcggtgtcaggggctgtgaatgattctataaaggccatagcc
tctattgctgaaaagtactttggttctacaggacttgtgggtctacaagacaaaaaagtt
ggagccttaccttacccttccatgtttcccctcccattttttccagcattctctcagtca
atgtacccatttcctgatagagacttgagaacgttacctttgaaaatggaaccccaatcg
ccaggagaagtcaagaagatcacaaagggaaacgccgagtctccctttgacctcaccact
aaacgtaaggaggagaaaccacttactcctgtgacctcgaaaccagcaactctaccagtt
accagccaggaccagcctctagatttgagtatgggcagcaggagccgagccagtggtaca
aaacagactgagcctcggaaaaaccacatctttggaggaaagaagggagatgaccttgaa
tcgaggaagtcgtcggacatatctttacagcatgcaaggcctactcctttctttatggat
cccatttacagagtagagaaacgaaaattaaccgatccacttgaagctttaaaggaaaag
tacttgaggccgacagcgggattcttgtttcatccacacatgtcagccatagaaaacatg
gccgaaaagctagagagttttagtgccctgaaaccagaagccagtgacctcatacagtcc
gtcccttccatgttcaacttccgagccccaccaagcaccttgccggagaatcttctgcgt
aagggcaaagaacgctatacctgcagatactgtggcaagattttcccaagatctgcaaat
ctaacccgtcacctgaggacacacactggagagcagccttacagatgcaaatactgtgac
aggtcttttagcatatcatctaacctgcagagacatgttcgtaacatccacaacaaggag
aagcccttcaaatgtcacttgtgtgacaggtgctttggccaacaaaccaacttagacaga
cacctcaaaaagcacgagaatggcaacatgtctggtactgctacgtcttcaccacactcc
gaacttgaaagcacaggggccatcctagatgacaaagaggactcgtattttacagaaatt
cggaatttcattgggaatagtaaccataacagttcagaagaaagaatgaatggaagtcac
tttaaagatgaaaagactttggtggcgagccagaactcggatttgttggaggacgaagaa
gcggaggatgaagtaatgatggacgaagaagatgaagaaagcgaaataacggggaagcca
gttaaagaacctgcggcaagcagcatatgtgaagatgccaccgagggagactatgaagaa
gaaaatgctttggaaatgaactgcaagtcttctcccggcaggtataaggaagaagatttt
aataaaactggactttctgctttggaccatatcaggcacttcactgatagcctcaaagtg
aggaaaatggaagaaagccagtttagtgaagctgagctggcatcattcggcacctcccat
cttccagaagacttaaagcaaccattgtatcgcaagtccaaatcccaggcatatgctatg
atgctttcgctctccgacaaggataccctccactctgcatcccacaattcctccaacatg
tggcacagtatggcaagagccgctgcagaatccagtgctattcagtccattagtcatgta
tga

DBGET integrated database retrieval system