KEGG   Gekko japonicus: 107126080Help
Entry
107126080         CDS       T04299                                 

Gene name
GATC
Definition
(RefSeq) glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
gja  Gekko japonicus
Pathway
gja00970  Aminoacyl-tRNA biosynthesis
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107126080 (GATC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gja03029]
    107126080 (GATC)
Enzymes [BR:gja01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     107126080 (GATC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     107126080 (GATC)
Mitochondrial biogenesis [BR:gja03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    107126080 (GATC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 107126080
NCBI-ProteinID: XP_015285067
Position
Un
AA seq 156 aa AA seqDB search
MWALRVSSLARAAFCSRSGNSAGLSSVPPFQEDGRGRKKVTLELLDHLERLALVDFRNQE
GVERLEKAIEFADQLLSINTDGVEPMDSVLEDRCLYLREDNVTEGNFAEELLKNANQTLE
EYFIAPPGNIPLPKLEDRDTFLQKKKPSADMLPLTF
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtgggctctccgtgtcagtagtttggcccgtgcggctttctgttctcggagtggtaac
tctgcagggctctcttctgttccgccatttcaggaggatggacgcggcaggaaaaaagta
actttggagttgctggatcatctggagcgtcttgcacttgttgatttccgcaatcaggag
ggtgtggaacgtttggagaaagcaatcgaatttgccgatcaacttctttccattaacacg
gatggtgtggagccaatggactcagtactggaggacaggtgtttgtatctcagggaagat
aatgtcacagaaggcaactttgcagaggagctactgaagaatgccaatcagacactggaa
gagtatttcatagctccaccagggaacatcccattaccaaagttagaagaccgagacact
ttcctgcagaagaaaaagccctcagcagacatgctaccactgactttttag

DBGET integrated database retrieval system