KEGG   Geobacillus genomosp. 3: M493_10200Help
Entry
M493_10200        CDS       T02798                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
gjf  Geobacillus genomosp. 3
Pathway
gjf00790  Folate biosynthesis
gjf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M493_10200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gjf04147]
    M493_10200
Enzymes [BR:gjf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     M493_10200
Exosome [BR:gjf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M493_10200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AGT32301
UniProt: S6A2J7
Position
complement(1923048..1923353)
Genome map
AA seq 101 aa AA seqDB search
MRLTEEEVQALLEKADGWKLADERWIVKKYRFQDYLQGIEFVRRIAAISENANHHPFISI
DYKLITVKLSSWRAKGLTKLDFDLAKQYDDVYQQMKQGEGE
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
gtgcggttaacggaagaggaagtgcaagcactgcttgaaaaagcggacggctggaagctg
gccgatgagcggtggattgtgaaaaaataccgttttcaagactacttgcaaggaatcgag
ttcgtccggcgaatcgccgcgatttcggaaaacgccaatcaccacccgttcatttcaatc
gactataagctgatcacagtgaagctgtcttcatggcgggcgaaagggctgacgaagctc
gattttgacctggcgaagcagtacgatgacgtgtatcaacagatgaagcagggggaaggg
gaatga

DBGET integrated database retrieval system