KEGG   Geobacillus genomosp. 3: M493_11720Help
Entry
M493_11720        CDS       T02798                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
gjf  Geobacillus genomosp. 3
Pathway
gjf00520  Amino sugar and nucleotide sugar metabolism
gjf01100  Metabolic pathways
gjf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    M493_11720
Enzymes [BR:gjf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     M493_11720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AGT32592
UniProt: S5Z6U7
Position
complement(2191780..2193012)
Genome map
AA seq 410 aa AA seqDB search
MKRWLLKNATVYAETGKIEQGYVLIAGEKVADIGPMSLCPTDIDAKVVELSPQFAVVPGF
IDVHIHGAAGADVMDATPAALHTMANTLPAEGTTSFLATTMTAPSEQIEAALRNVARYMA
EANRPGAAEVLGVHLEGPFLSPKRAGAQHPRHLVDPDVSLFQRWQEAAGGHIRLVTLAPE
RDEGLALTAYLKETGVIASIGHSDAVYEEVKAAIAAGVTHATHLFNGMRGIHHREPGVAG
GVLMHEEVMCELIADGLHVAPPMVRFAYRNKGSEGLILITDAMRAKCLGDGQYDLGGQEV
SVRGGEARLADGTLAGSVLKLGEAIRHVLDYTGCTLEEVIRMASWNPAKQLRVSDRKGSL
HPGKDADLVILNEQYEVIMTFCRGVLAYSKPIGTERLGTGGNGHEAHRNS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtggctgctgaaaaacgctacagtgtatgcggaaacggggaaaatcgaacaa
gggtatgtgctgatcgcaggagagaaagtggccgacatcggtccgatgtcgttatgccca
accgatatcgatgcgaaagtggtcgagctttccccgcagtttgctgtcgtgcctggtttc
attgacgttcatatccatggggcggcgggggccgatgtgatggatgcaacgccggcggcg
cttcacacgatggccaacaccttgccggcggaagggacgacaagtttcctggcgacgaca
atgacggcgccaagtgaacaaattgaagcggcgcttcgaaatgtcgcccgttatatggct
gaggcgaatcgcccgggggcggcggaggtgctcggcgttcatttggaagggccgtttttg
tcgccgaagcgcgccggggcgcaacacccgcgccatctcgtcgaccctgacgtttcgctg
tttcagcgctggcaagaagcagccggcggacacattcgccttgtgacgcttgccccggag
cgggacgaggggcttgcgctcaccgcctatttaaaggaaacgggggtgatcgcttcgatc
ggccattccgatgccgtctacgaagaagtgaaagcggccatcgccgccggggtgacgcac
gctactcatttatttaacgggatgcgcggcattcaccaccgcgagccgggcgtggccggc
ggagtgctcatgcatgaggaagtcatgtgcgaactgatcgccgacgggctgcacgtcgcg
ccgccaatggttcgtttcgcttaccggaataaaggaagcgagggactcatattaatcacc
gatgcgatgcgcgccaaatgtcttggcgacgggcaatacgatctcggcggccaggaagtg
tccgtccgcggcggggaggcccggcttgccgacggcacgctggcgggaagcgtactcaag
cttggcgaggccattcgccatgtgctcgactataccggctgcacgctcgaagaggtcatc
cgcatggcgagctggaatccggctaagcagctccgtgtgtctgaccggaaaggaagtttg
catccgggcaaagatgccgaccttgtcatcttgaacgaacaatacgaagtgatcatgacg
ttttgccgcggtgtgcttgcctacagcaagccaatcggaacagaaaggctaggaacaggg
gggaacggccatgaagctcatcgaaacagctga

DBGET integrated database retrieval system