KEGG   Geobacillus genomosp. 3: M493_14950Help
Entry
M493_14950        CDS       T02798                                 

Definition
(GenBank) glycogen branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gjf  Geobacillus genomosp. 3
Pathway
gjf00500  Starch and sucrose metabolism
gjf01100  Metabolic pathways
gjf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gjf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M493_14950
Enzymes [BR:gjf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     M493_14950
Exosome [BR:gjf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M493_14950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM Glyco_hydro_70 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AGT33227
UniProt: S5Z8T8
Position
complement(2792409..2794406)
Genome map
AA seq 665 aa AA seqDB search
MIAANPTDLEVYLFHEGSLYKSYELFGAHVIDEGGRAATRFCVWAPHARDVRLVGSFNGW
DGTKFRLTKVNDEGVWTIVVPENLEGHLYKYEIVTPDGRVLLKADPYAFYSELRPHTASI
VYDLQGYQWNDQSWQRKKRRKRIYEQPMVIYELHFGSWKKKDGHVYTYREMADELIPYVL
EHGFTHIELLPLVEHPLDRSWGYQGTGYYAATSRYGTPHDLMHFIDRCHQAGLGVIVDWV
PGHFCKDAHGLYMFDGAPTYEYANEKDRENYVWGTANFDLGKPEVRSFLISNALFWLEYY
HVDGFRVDAVANMLYWPNNDRLYENPYAVEFLRKLNETVFAHDPNVLMIAEDSTDWPRVT
APTYEGGLGFNYKWNMGWMNDMLKYMETPPHERKHVHNQVTFSLLYTYSENFILPFSHDE
VVHGKKSLLNKMPGAYDEKFAQLRLLYGYMMAHPGKKLLFMGNEFAQFDEWKFEEELDWV
LFDFDLHRKMNEYMKQLIACYKRYKPFYELDHDPQGFEWIDVHNAEQSIFSFIRRGKKDD
DVLIIVCNFTNQAYDDYKVGVPLFTPYREVLNSDAVDFGGLGHVNSKRLPAFNEPFHGKP
YHVRMTIPPFGISVLRPVQKRGERKQNEEDVHRHVIGRRARKPASLADEKHRETGRAVRR
EVSDH
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
ttgattgcggcgaatccgacggatttggaagtgtatttgtttcatgaaggcagcttgtat
aaaagctacgaactgtttggcgcccatgtgatcgatgagggcggaagagccgccactcgc
ttttgcgtctgggcgccgcacgcgcgcgatgtgcgcctggtcggcagcttcaacggctgg
gacgggacgaaattccgcctcaccaaagtgaacgatgaaggagtatggacgatcgttgtc
ccggaaaacttggaagggcatttatacaagtatgagatcgtcacgccggatggacgtgtg
ttgttgaaagcagacccgtacgccttttactccgaattgcgtcctcataccgcctcgatt
gtctacgatctgcaaggataccagtggaacgatcagtcttggcagcggaagaagcggcgg
aagcggatttatgagcaaccgatggtcatttatgagctccatttcggttcgtggaagaaa
aaggatggtcatgtttatacgtaccgcgagatggccgatgaactcattccgtatgtgctc
gagcatgggtttacgcatatcgagctgcttccgcttgttgagcacccgctcgaccgttcg
tggggctatcaagggaccgggtattacgcggcgacgagccgttatggcaccccgcacgat
ctcatgcatttcatcgaccgctgccatcaagcgggacttggggtcatcgtcgattgggtg
ccggggcatttttgcaaggacgcccacgggctgtacatgtttgacggcgccccgacgtat
gaatatgcgaacgaaaaagaccgcgaaaattacgtctgggggacggccaattttgacttg
ggcaagccggaagtgcgcagctttctcatctccaatgcgttgttttggcttgagtattac
cacgtcgatggattccgcgtcgatgcggtcgcgaacatgctgtattggccgaacaacgac
cggttgtatgaaaatccgtatgcggtcgagtttttgcgcaagttaaacgagacggtgttt
gcccacgacccgaacgtgctcatgattgccgaagactcgaccgactggccgcgggtgacg
gcgccgacgtatgaaggggggcttggctttaactataagtggaacatgggctggatgaac
gacatgttgaagtacatggaaacgccgccgcatgagcggaagcatgtgcacaaccaggtg
acgttttccctcctttatacgtattcagaaaatttcattttgccgttttcccacgatgaa
gtcgtgcacggcaaaaagtcgctgctcaacaaaatgccgggggcgtatgacgagaagttc
gcccagctgcggctgctgtacggctacatgatggcccatcccgggaaaaagctgttgttt
atgggcaacgaatttgcccaatttgacgaatggaagtttgaagaagagctcgattgggtg
ttgttcgactttgacttgcaccggaagatgaacgagtatatgaaacagctcatcgcctgc
tataagcggtataagccgttttacgaactcgaccatgacccgcaaggatttgaatggatt
gacgtccataatgccgaacaaagcattttctcgttcatccgccgcgggaaaaaagacgat
gacgtgttgatcattgtttgcaatttcacaaatcaggcgtatgatgactacaaagtcggc
gtgccgcttttcacgccgtatcgggaagtgctgaacagcgatgcggtggactttggcgga
ttagggcatgtcaattcgaagcggcttccggcgttcaatgaaccgtttcacggaaagccg
taccatgtgcgcatgacgattccgccatttggcatttcagtgttacggccagtgcaaaaa
cgaggggagagaaagcaaaatgaagaagacgtgcatcgccatgttattggccggcgggca
aggaagccggcttcgctcgctgacgaaaaacatcgcgaaaccggccgtgccgttcggcgg
gaagtatcggatcattga

DBGET integrated database retrieval system