KEGG   Geobacillus genomosp. 3: M493_15335Help
Entry
M493_15335        CDS       T02798                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
gjf  Geobacillus genomosp. 3
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    M493_15335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF2301
Motif
Other DBs
NCBI-ProteinID: AGT33283
UniProt: S5ZS70
Position
complement(2845855..2846853)
Genome map
AA seq 332 aa AA seqDB search
MDMILVLTICIVIFALAFDFINGFHDTANAIATSVSTRALTPRKAIILAATMNFIGALTF
TGVAKTITKDIVDPFALENGPVIILAALTSAIAWNLITWYYGIPSSSSHALIGSIAGAAI
SAAGVGILNYGGFLKILESLILSPFLALGVGFVIMSLFRLIFKNANLYSTTRGFRLFQIV
TAALQSYTHGTNDAQKAMGIITMALIAGGYHATTDIPEWVRISAALAMGLGTAVGGWKII
KTVGGKIMKIRPINGAAADLSSALVIFTATTFHLPVSTTHVISSAIMGVGAAQRVKGVKW
GVARRIVLTWIITLPISALMAGFLYQLFNLFL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatatgattttagttttgacgatatgcattgtgattttcgcgctggcgtttgacttt
attaacgggttccacgatacagcgaacgccatcgcgacgtcggtgtcgacgagggcgctg
acgccgcgcaaagccattattctcgcggcgacgatgaactttatcggcgcgctcaccttc
accggtgtcgccaaaacgattacgaaagacatcgtcgacccgttcgcgctcgaaaacggg
ccggtcatcattttggcggcgctcacgtcggcgatcgcctggaacttgattacgtggtat
tacggcatcccgagcagctcttcgcacgcgttgatcggttcgatcgccggagcggcgatt
tccgcagccggggtcgggattttgaactatggcggctttttaaaaattttggaatccctc
attctttctccgtttttggcgttaggggtcggctttgtcattatgagtctttttcgtttg
atctttaaaaacgccaacttgtacagcacaacgcggggattccgcctgtttcaaatcgta
actgcggcattgcagtcgtatacacatggaacgaacgacgcccaaaaggcgatggggatt
attacgatggcgctcattgccggcgggtatcatgcgacgaccgatattccggagtgggtg
cgcatttccgccgccttggccatggggcttggaacggcggtcggcggttggaaaatcatc
aaaacggtcggcgggaagattatgaaaatccgcccgatcaacggcgcggcggccgactta
tcgtccgcgctcgtcattttcacggcgacgacgttccatttgccggtcagcacgacgcac
gtcatttcgtcggcgatcatgggggtcggcgccgcccagcgcgtgaaaggcgtcaaatgg
ggtgtcgcccgccgcattgtgctcacttggatcatcaccttgccgatttcggcgttaatg
gccggttttctgtaccagctgttcaatttgtttttgtaa

DBGET integrated database retrieval system