KEGG   Geobacillus genomosp. 3: M493_17765Help
Entry
M493_17765        CDS       T02798                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gjf  Geobacillus genomosp. 3
Pathway
gjf00071  Fatty acid degradation
gjf00072  Synthesis and degradation of ketone bodies
gjf00280  Valine, leucine and isoleucine degradation
gjf00310  Lysine degradation
gjf00362  Benzoate degradation
gjf00380  Tryptophan metabolism
gjf00620  Pyruvate metabolism
gjf00630  Glyoxylate and dicarboxylate metabolism
gjf00640  Propanoate metabolism
gjf00650  Butanoate metabolism
gjf00900  Terpenoid backbone biosynthesis
gjf01100  Metabolic pathways
gjf01110  Biosynthesis of secondary metabolites
gjf01120  Microbial metabolism in diverse environments
gjf01130  Biosynthesis of antibiotics
gjf01200  Carbon metabolism
gjf01212  Fatty acid metabolism
gjf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M493_17765
   00630 Glyoxylate and dicarboxylate metabolism
    M493_17765
   00640 Propanoate metabolism
    M493_17765
   00650 Butanoate metabolism
    M493_17765
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M493_17765
   00072 Synthesis and degradation of ketone bodies
    M493_17765
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M493_17765
   00310 Lysine degradation
    M493_17765
   00380 Tryptophan metabolism
    M493_17765
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M493_17765
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M493_17765
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M493_17765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gjf04147]
    M493_17765
Enzymes [BR:gjf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M493_17765
Exosome [BR:gjf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M493_17765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD DUF2496 ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGT33759
UniProt: S5Z3Y8
Position
complement(3319388..3320566)
Genome map
AA seq 392 aa AA seqDB search
MGKAVIVSGVRTPFGKLGGSLQALSAAELGGIAVKEALARANVSAEQVDHVILGTVLQGG
QGQLPSRQAMRHAGIPWHVRTETVNKVCASGMRAVTLADQLIRLGEADVVVAGGMESMSN
APYVLPKARWGLRMGDSTVKDLMVYDGLTCSFTGVHMGVYGGNTARELGITREAQDEWAY
RSHMRAIAAIEAGRLAEEIVPVSIPQRKGEPLIVEHDEAPRKDTSLEKLAKLAPVFDPQG
TITAGNAPGVNDGAAALVLMSEERAAREGFEPLATVVAHTAIAVEAKDFPKTPGLVINEL
LRKTGKTVDDIDLFEVNEAFAAVALAAIQIAGLDPEKVNVNGGAVALGHPIGASGARIIL
TLAHELKRRGGGLGIAAICSGGGQGDAILIEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagcagtgattgtaagcggggttcgcaccccgttcggaaaattgggaggttct
ttgcaagcgctgtcagcagcggagcttggcggcattgccgtgaaggaggcgctcgcccgc
gccaatgtgagcgccgaacaagtggatcatgtcattttgggcaccgtcttgcaaggcgga
caagggcagctcccgtcgcgccaggcgatgcgccatgccggcatcccgtggcacgtccgc
accgagacggtgaacaaagtatgcgcatccggcatgcgtgccgtgacgcttgccgatcag
ctcatccgtttaggcgaggcggatgtcgtcgtcgccggcgggatggaatcgatgagcaac
gccccgtatgtgcttccgaaagcgcgctgggggctgcggatgggcgacagcacggtgaaa
gatttaatggtgtatgacggcctcacgtgcagcttcaccggtgttcatatgggcgtctac
ggcgggaatacggcgcgtgagcttggcattacaagagaggcgcaagacgaatgggcatac
cgcagccatatgcgcgccattgccgccatcgaagccggacggctggcggaagaaatcgtg
ccggtttcgatcccgcagcgcaaaggcgagccgctcattgtcgagcacgacgaggcgcca
agaaaagatacgtcactggaaaagctggccaaactggcaccggtatttgacccgcaaggc
acgattacggccggcaacgccccgggcgtcaacgatggcgctgcggcgctcgtcttaatg
agcgaagagcgcgccgcccgggaagggttcgaaccgctcgcaacggtcgtcgcccacacg
gccatcgccgtcgaggcgaaagatttcccgaaaacgccggggcttgtcatcaacgaactg
ctccgcaaaacaggaaagaccgttgacgacattgacttgttcgaagtgaacgaagcgttt
gccgcggttgcgcttgccgccattcaaatcgccgggcttgatccggaaaaagtaaacgtc
aacggcggcgctgtcgccctcggtcatccgatcggcgcgagcggggcgcgcatcatcttg
acgctcgcccatgagttgaagcgccgcggcggagggctgggcattgccgcgatttgcagc
ggcggcggtcaaggcgacgccatcttaatcgaagtataa

DBGET integrated database retrieval system