KEGG   Geobacillus kaustophilus: GK2115
Entry
GK2115            CDS       T00217                                 
Name
(GenBank) transcriptional regulator
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
gka  Geobacillus kaustophilus
Brite
KEGG Orthology (KO) [BR:gka00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gka03000]
    GK2115
Transcription factors [BR:gka03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    GK2115
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 HTH_Tnp_ISL3 HTH_38 HTH_31 HTH_6 HTH_10 HTH_23 HTH_7 HTH_24
Other DBs
NCBI-ProteinID: BAD76400
UniProt: Q5KY36
Position
complement(2156950..2157963)
AA seq 337 aa
MASIKDVAKRANVSTATVSRVLRNAGNVTEETRQRVLEAIEALNYQPNVLGRYLRRMETE
TVLVVVPDITNPFFSKVLRGIEAVALEHGYQVLLGDTQNDVRLEEQYLNLLPQRQVDGMI
FLTARIRKELVEEMARQFPIVLACEYLEGADIPTVSIDNISSARKATEHLIRLGHRRIAH
LSGPMNIILSRDRLRGYQQALAQHELEADAALVQEGDFTYESGYNLTLKLLALEKPPTAI
FAANDEMAIGAIKAVRHRGGRVPDDVAVVGFDDIQMASIFEPSLTTIAQPMFEIGQKAME
LLLALIEGTSARRRQLVLPDRLVIRDSCGGERSEQRG
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcaagcataaaagacgtggcgaaacgggcgaacgtatcgacggccaccgtgtcgcgc
gtgctgcgcaacgcgggcaacgtcactgaagagacaaggcagcgcgtgctcgaagccatt
gaagcgctgaactaccagccgaacgtgctcggccggtatttgcggcggatggagaccgag
acggtgctcgtcgtcgtgcccgatattacgaatccgtttttctcgaaggtgctgcgcggc
attgaagcggtcgccctcgagcacggctatcaggtgctgcttggcgatacgcaaaacgat
gtccggcttgaggagcagtatttgaatttgctgccgcagcggcaagtcgacgggatgatt
tttttgaccgcccgcatccgcaaagagctggtggaagagatggcgcggcagtttccgatc
gtcttggcgtgcgagtatttggaaggggcggacatcccgaccgtttcgatcgacaacatc
agcagcgcccgcaaggcgacagaacacttgatccgtctcggccatcgccgcattgcccac
ctgtccgggccaatgaacatcattttaagccgcgaccggctgcgcggctaccaacaggcg
ttggcgcagcatgagcttgaggcggacgccgcgctcgtgcaggaaggcgattttacctat
gagtccggatataatttaacgttgaaactgctcgctcttgagaagccgccgacagcgatt
ttcgccgccaacgatgagatggcgattggggcgatcaaagcggttcgccatcgaggcgga
cgcgttcccgacgatgtggccgttgtcggatttgacgacattcaaatggcctcgattttt
gaaccgagcctcacgacgatcgcccagccgatgtttgagatcgggcaaaaggcgatggaa
ttgctgcttgcgctcattgaaggaacgagcgcgcggcggcgtcagcttgttcttcccgat
cggctcgtcattcgcgattcgtgtggaggagagcgctctgagcaaaggggctga

DBGET integrated database retrieval system