KEGG   Geobacillus kaustophilus: GK0387Help
Entry
GK0387            CDS       T00217                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase
Organism
gka  Geobacillus kaustophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ThiF
Motif
Other DBs
NCBI-ProteinID: BAD74672
UniProt: Q5L308
Position
432857..433816
Genome map
AA seq 319 aa AA seqDB search
MSGWGWCDAMNIQRILVTGRLYAELAALLPNKRPDKEFRFVAEEELTANDFAWADAYVGF
RPAGPFSLANLRWVHSLGAGVDAFLWKREWKKNVLLTRTIGSFGEQIAEYCLSYLLRDAQ
CHDVYAWYQEQRQWKPLAPKRLGEQRIVIYGTGEIGRRIAETLRLFGVSPIGVSRSGRDT
PPFSAVCRHEEAGEALACADWVIAALPLTEETHHLFDETFFACLHNAGFINVGRGATVDE
TALIGALENRNVRLAVLDVFEEEPLPPHSPLWVHPNVIITPHIAALTSVDAAAHSVLDTL
RCIETGEPLANAVDVSRQY
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgagcggttgggggtggtgtgatgccatgaacatccaacgcattctcgtgacgggaagg
ctttatgccgagcttgccgcccttctcccgaacaagcggccggataaagagtttcgcttt
gtggcggaagaagaattgacggccaatgatttcgcctgggcggatgcgtacgtcggcttt
cgtccggccgggccgttttcgctcgccaatttgcgctgggtgcattcgctcggcgcgggc
gttgacgcgtttttgtggaagcgggaatggaagaagaacgtgttgctgacgcggacgatc
gggtcatttggcgagcagatcgccgaatattgcctcagctacttattgcgcgacgcccaa
tgtcatgacgtgtatgcatggtatcaagaacagcggcagtggaagccgctcgctccgaaa
cggcttggtgaacagcggattgtcatttatgggacgggtgagatcggccggcgcatcgcg
gaaacgcttcgtctgttcggcgtttcgccgatcggcgtatcgcgaagcggccgagacacg
ccgccgttttcggctgtttgccgccatgaagaggcgggggaagcgcttgcttgcgctgat
tgggtgatcgctgcgcttccgctgacagaggaaacgcatcatctctttgacgagacgttt
tttgcctgtttgcacaacgcgggctttatcaatgttgggcgtggggcgacggttgatgag
acggcgcttatcggcgccttggaaaaccgaaatgtccgcctggcggtgctcgatgtgttc
gaagaagagccgctgccgccgcactcgccgctttgggttcatccgaatgtcatcattacc
cctcatatcgcggcgctgacatcagttgacgccgccgcccatagcgttttagacacgctc
cgttgcatcgaaaccggcgaaccgcttgccaatgcggtcgatgtgagccggcaatattga

DBGET integrated database retrieval system