KEGG   Geobacillus kaustophilus: GK0731Help
Entry
GK0731            CDS       T00217                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00010  Glycolysis / Gluconeogenesis
gka00071  Fatty acid degradation
gka00350  Tyrosine metabolism
gka00625  Chloroalkane and chloroalkene degradation
gka00626  Naphthalene degradation
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01120  Microbial metabolism in diverse environments
gka01130  Biosynthesis of antibiotics
gka01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GK0731
  Lipid metabolism
   00071 Fatty acid degradation
    GK0731
  Amino acid metabolism
   00350 Tyrosine metabolism
    GK0731
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GK0731
   00626 Naphthalene degradation
    GK0731
Enzymes [BR:gka01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GK0731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Methyltransf_25 3HCDH_N TrkA_N
Motif
Other DBs
NCBI-ProteinID: BAD75016
UniProt: Q5L214
Position
complement(759990..761000)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVHKFKQKLQIEEVEKPKLGYGEVLVKIEACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVVEIGEGVKSIQIGDRVGIPWLYSACGECEYCLSGQETLCPHQLNGGYSVDGSY
AEYCKAPANYVARIPKNLDPVQVAPILCAGVTTYKALKVSNAKPGEWVAIYGIGGLGHIA
LQYAKAMGLNVVAVDISDEKAELAAKLGADITINGLQEDPVAAIREKVGGVQAAISVAVT
KKAFEQAYQSVRRGGCLVIVGLPHDELPIPIFDTVLNGVTIKGSIVGTRKDMQEALDFAA
RGKVRPIVEAVPLEKINEVFERMEKGQINGRVVLTM
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgttgttcacaaattcaagcaaaaacttcaaattgaagaagtggagaaa
ccaaaactaggatatggcgaagtgcttgtgaaaattgaagcttgtggcgtctgccatacc
gatttgcatgcggctcatggggattggccggtaaaaccgaaacttccacttattcctggt
catgaaggggtaggaattgttgttgagatcggtgagggagtgaaatcaatccaaattggc
gaccgtgttggcattccatggttatactcagcatgcggtgaatgtgaatattgtttaagc
ggtcaagaaacactttgtccacatcaattaaacggtggatactctgtcgatggcagttat
gcagaatattgcaaagccccggccaattatgtcgcacgaattcctaaaaacctcgatccc
gtacaagttgctcctattctttgtgctggggtcacaacgtataaagcattaaaagtttca
aatgccaagcctggcgaatgggtcgctatttatggaatcgggggattgggccatattgct
cttcaatatgccaaggcaatgggattaaatgttgttgctgttgatatcagtgatgaaaag
gcagaacttgcggcaaagttgggtgctgatattacgatcaatggattgcaagaagaccct
gtagcagccattcgtgaaaaagtaggcggagtacaagcggctattagcgttgctgtaacg
aaaaaagcgttcgaacaagcttatcaatccgtgcgacgcggcggctgccttgtcatagtt
ggactgcctcacgatgaactgccgattcctatttttgacactgtattaaatggcgttacg
ataaaaggttcgatcgtcggtacacgaaaagatatgcaagaagctctagatttcgccgca
cgcggaaaagttcgccctattgtggaagcggtaccattagaaaaaattaacgaagtattt
gaacggatggaaaaaggtcaaatcaatggccgcgttgttttaacaatgtaa

DBGET integrated database retrieval system