KEGG   Geobacillus kaustophilus: GK0926Help
Entry
GK0926            CDS       T00217                                 

Definition
(GenBank) N-acylamino acid racemase
  KO
K02549  O-succinylbenzoate synthase [EC:4.2.1.113]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00130  Ubiquinone and other terpenoid-quinone biosynthesis
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    GK0926
Enzymes [BR:gka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     GK0926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C Aldolase
Motif
Other DBs
NCBI-ProteinID: BAD75211
UniProt: Q5L1G9
Position
949470..950597
Genome map
AA seq 375 aa AA seqDB search
MAINIEYVILRHLQMELKAPFTTSFGTFQTKELILVEAVDCDGVSGWGESVAFSAPWYSE
ETVKTNWHMLEEFLVPLLFSKPLRHPAELPERFAAIRQNNMAKAALEGAVWDLYAKRLGV
PLCQALGGTKKEIEVGVSIGIQPTVADLLQVIERYVAQGYRRIKVKIKPGWDVDVIRDVR
RAFPDVPLMADANSAYTFADAKRLQALDEFGLMMIEQPLAADDLVDHARLQPLLQTPICL
DESIRSYDDARKALDLGSCRIINIKIGRVGGLWEAKRIHDLCAERGVSVWCGGMLEAGVG
RAHNIAITTLENFALPGDTAASSHYWERDIITPEVEVQGGLIRVPNAPGIGYEVDRRQVE
RYTQFAKVFHRTATA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaacatcgagtacgtcatattgcgccatttgcaaatggagttgaaggcgccg
tttacaacgagcttcggcacgtttcaaacgaaagagttgattttagtggaggcggtcgac
tgcgatggggtttccggctggggcgaatcggttgcgttttctgccccgtggtacagcgag
gaaacggtgaaaacgaactggcatatgcttgaagagtttctcgtgccgctcttgttttcg
aagccgcttaggcatccagcggaattgccagagcgctttgccgccatccgccaaaacaac
atggcgaaagcggcgcttgagggagcggtatgggatttgtatgccaagcggctcggcgtc
ccgctttgtcaagctctcgggggaacgaaaaaggaaattgaagtcggcgtcagcatcggc
atccagccgacggttgccgatctgctccaggtgattgagcggtatgtggcgcaagggtac
cggcggatcaaagtgaagatcaaaccgggatgggatgttgatgtcattcgcgacgtgcgg
cgcgcgtttcccgacgtgccgctcatggcggatgccaattcggcgtatacgttcgctgac
gccaagcggcttcaggcgctcgatgaatttgggctgatgatgatcgaacagccgctcgcc
gctgacgatcttgtcgatcacgcccggctgcagccgcttcttcagacgccgatttgcctt
gatgaaagcattcgttcctatgacgatgcgcgcaaggcgcttgaccttggcagctgccgc
atcatcaacatcaaaatcgggcgcgtcggcgggctttgggaggcgaagcgcatccacgat
ctttgcgctgagcgcggcgtttcggtctggtgcggggggatgctggaagcaggggtcggg
cgcgcccacaatatcgcgatcacgacgttggaaaacttcgcgcttcccggcgacaccgcc
gcgtcgtcccattattgggagcgggatattatcacaccggaagtcgaggtgcaaggcggc
ttgatccgcgtgccgaacgccccgggcatcggctatgaagtcgaccgccgccaagtggag
cggtatacgcagtttgcgaaggtgtttcatcgtacggcgacggcataa

DBGET integrated database retrieval system