KEGG   Geobacillus kaustophilus: GK0954
Entry
GK0954            CDS       T00217                                 

Definition
(GenBank) hypothetical conserved protein
  KO
K08966  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase [EC:3.1.3.87]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00270  Cysteine and methionine metabolism
gka01100  Metabolic pathways
Module
gka_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GK0954
Enzymes [BR:gka01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.87  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
     GK0954
SSDB
Motif
Pfam: HAD Hydrolase
Other DBs
NCBI-ProteinID: BAD75239
UniProt: Q5L1E1
Position
976054..976716
AA seq 220 aa
MTKQLVLFCDFDGTITENDNIIAIMKQFAPPEWEALKDDILAERISVQEGVGKMFSLLPS
SLKGEIIDFLRRTTRLRAGFREFVAFTKERGIPLYIVSGGIDFFVYPLLEGLIEPERIFC
NGSDFSGETIRITWPHACDGECQNGCGCCKPSLLRKLARPDGYHVVIGDSITDLAVAKQA
DYVMARDFLLQKCQELGLPHAPFATFFDVIDALQRMEVIV
NT seq 663 nt   +upstreamnt  +downstreamnt
atgacgaaacagctcgttctcttttgtgattttgacggcaccattacggaaaacgacaac
atcatcgctattatgaaacagttcgccccgccggagtgggaggcgttaaaagacgacatt
ctcgctgagcgcatttctgttcaggaaggagtggggaagatgttttccctccttccgtcc
tcgctaaagggagaaatcatcgatttcctgcggcgcaccacccggttgcgcgcgggattc
cgagagtttgtcgcgtttacgaaagagcgaggcattccgctttatatcgtcagcggcggc
atcgacttttttgtctatccgctgcttgaagggctcattgaaccggagcgcattttttgc
aacggctccgatttcagcggtgagacgatccgcatcacatggccgcatgcatgcgacggt
gagtgccaaaacggctgcggctgctgcaagccatcgctccttcgcaagcttgcccgcccg
gacggataccatgtcgtcatcggcgattcgattacggatttagcggtggcgaagcaagcg
gattacgtgatggcgcgcgattttctgctccaaaaatgccaagagctcggcttgccgcat
gcgccgtttgcaacgttttttgacgtgattgatgcgttgcagcgaatggaggtgatcgta
tga

DBGET integrated database retrieval system