KEGG   Geobacillus kaustophilus: GK1115
Entry
GK1115            CDS       T00217                                 

Gene name
murE
Definition
(GenBank) UDP-N-acetylmuramoylananine-D-glutamate-2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00300  Lysine biosynthesis
gka00550  Peptidoglycan biosynthesis
gka01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    GK1115 (murE)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GK1115 (murE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gka01011]
    GK1115 (murE)
Enzymes [BR:gka01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     GK1115 (murE)
Peptidoglycan biosynthesis and degradation proteins [BR:gka01011]
 Precursor biosynthesis
  Amino acid ligase
   GK1115 (murE)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase MoCF_biosynth ADH_zinc_N_2
Other DBs
NCBI-ProteinID: BAD75400
UniProt: Q5L0Y0
Position
1135297..1136766
AA seq 489 aa
MKLLTLLSHLPGFWVHHGGNPDIVALEMDSRRVASGSLFFCLKGFTVDGHDFAEEAVARG
AAAIVAERPLSVDVPVVLVSDSRRAMAILADAFYGRPTHRLHLIGVTGTNGKTTTTSIIE
QIARKTGKKTGLIGTVHIKVGDRSYPAANTTPESLILQRTFKQMVDEGVEFVAMEVSSHA
LHQGRVHGCDYDVAVFTNLTQDHLDYHGTMEEYRNAKGLLFAQLGNRYDERRPKFAVLNH
DDPVSQYYKHMTAAPIVTYGMREKSDVMAEQIRMTAGGMAFRLCTPHGSAAVETKLVGSF
NVYNILAAAAACLASGFSLETIAAALADVEPVPGRFETVDEGQNFTIIVDYAHTPDSLEN
ALKTVRQLAKRNVYVVIGCGGDRDPSKRPLMAQVAVRYADVAIFTSDNPRSEDPKQILRD
MEAGVSAEIGKHVTIPDREEAIRYAIGQAQEGDVVLIAGKGHETYQIIGNDVIEFDDRAV
ARAAVKERG
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgaaactgctgacgctgctgtcacacttgcccggtttttgggtgcaccatggaggcaat
cccgatatcgtggcgctcgaaatggactcgcgccgcgttgcctccggttctctctttttt
tgccttaaagggtttacagtagacggacacgactttgccgaggaagcggtggcgcgcgga
gcggcggcgatcgtggccgagcggccgctttccgttgatgttcccgtcgttcttgtgtcg
gacagccggcgggcgatggcgattttagcggacgcgttttacgggcggccgacccaccgc
cttcatttaatcggagtgacaggcacaaacggcaagacgacgacaacgtcgatcatcgaa
caaatcgcgagaaaaaccggcaagaaaacagggctcattggcacggttcacatcaaggtc
ggcgaccgctcctatccggcggccaatacgacgccggagtcgctcattttgcagcgcacg
tttaaacagatggtcgatgaaggagtggagtttgtcgccatggaagtgtcgtcgcacgcg
ctgcaccaagggcgggtgcatggctgcgattacgatgtggccgtctttacgaacttaacg
caagaccatttggattatcacgggacaatggaagaatatcggaacgccaaagggcttttg
tttgcccagctcggcaaccgctacgacgaacggcggccgaaatttgccgttctcaatcat
gacgatccggtttcgcagtattataaacatatgacggccgcgccgatcgtcacatacggg
atgagggaaaaaagcgatgtgatggcggaacagatccgcatgaccgcaggcggcatggcg
tttcggctttgcacgccgcacggatcggcggcggtcgaaacgaaacttgtcggctcgttc
aatgtctataacattctcgccgctgccgctgcctgccttgcctctggcttttcgcttgaa
acgatcgccgcggcgcttgcggatgtcgagccggtgccggggcggtttgaaacggttgat
gaagggcaaaactttacgatcatcgtcgattacgcccacacgccggacagtttagaaaat
gccttaaaaacggtgcgccaattggcgaagcgaaacgtgtatgtcgtcatcggctgcggc
ggcgaccgcgacccgtcgaaacggccgctcatggcgcaggtggcggtgcggtatgcggat
gtcgctatttttacctccgacaatccgcgttcggaagacccgaagcaaattttgcgcgac
atggaagcgggagtaagcgctgagatcggaaagcatgtgacgattcctgaccgtgaagag
gcgatccgctacgccattggccaggcgcaggaaggcgatgttgtgttgattgccggcaaa
gggcatgaaacgtatcaaatcattggcaacgatgtgattgagtttgacgatcgcgctgtt
gcccgagcggcagtgaaggagagaggatga

DBGET integrated database retrieval system