KEGG   Geobacillus kaustophilus: GK1954Help
Entry
GK1954            CDS       T00217                                 

Definition
(GenBank) dehydrogenase
Organism
gka  Geobacillus kaustophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Adeno_PV
Motif
Other DBs
NCBI-ProteinID: BAD76239
UniProt: Q5KYJ7
Position
complement(1997873..1998877)
Genome map
AA seq 334 aa AA seqDB search
MDRFKVVVTDYEFQTLAPEQEVLSSLNVEFVATQCRTEEEVISACRDADAIINQYAPISA
EVIAQLEKCKIISRYGVGVNTVDVDAATEKGIIVANVTDYSIDEVSDHALALLLSLARKI
VKLNHEVKSGTWNFNVGKPIYRLRGRTLGLVGLGRIPQALAKKAQAFGLRVIAYDPYVPA
KVADELNVQLLGLNDVFRQSDYISVHAPLTKETKGMISDEQFNLAKKELIIVNTARGPVI
DESALIRALQEGKISGAGLDVTECEPIQPDNPLLKMENVVITPHVAWYSEESEKELKRKT
AQNVADVLSGYYPTYLVNHNVKEKMRLKEKGLYV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggatagatttaaagttgtggtgacagactacgaatttcaaacgttggcacctgaacaa
gaagtgctttcatctctcaatgtggagtttgtcgccacccagtgtcgtacagaggaggaa
gtcatttccgcgtgcagggacgccgacgccattatcaaccagtatgctccaatatctgca
gaggtaatcgcacaactggaaaagtgcaaaatcatttcccgatatggcgtcggtgtcaat
acagttgatgtagacgctgccaccgaaaagggtattattgtagccaatgtaacggactat
tcgatcgatgaggtctcggatcacgcgctggcgctgttgctttcgctagctcgcaaaatc
gtcaaattgaatcacgaagtaaagagtggtacatggaattttaatgtcggcaagccgatt
taccggctgcgggggagaacgctcggtcttgtgggattgggaagaattccgcaagcgttg
gcgaaaaaggcccaagcttttggactgcgcgttattgcctatgacccgtacgtccccgct
aaagtggctgacgagctcaatgttcaactgcttggactgaacgatgtgttccgacaatcg
gactacatttccgttcatgccccgttgactaaagaaacaaaaggaatgatcagcgacgaa
caatttaacttggcgaaaaaggaattgatcatcgtcaacacggctcgtggcccggtcatt
gatgaatccgctttaattcgcgctttacaagagggaaaaatcagcggcgctgggctcgat
gtgacggaatgtgagccgatccaaccggacaaccctctcctgaaaatggaaaacgtggtc
attactcctcatgtagcctggtattctgaggaatcggaaaaagaattaaaacggaaaacc
gctcaaaacgttgccgatgtattgtcgggatattatccgacctatcttgtcaaccataac
gtcaaggaaaagatgcgtttgaaagagaaagggctttatgtataa

DBGET integrated database retrieval system