KEGG   Geobacillus kaustophilus: GK2344Help
Entry
GK2344            CDS       T00217                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00030  Pentose phosphate pathway
gka00480  Glutathione metabolism
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01120  Microbial metabolism in diverse environments
gka01130  Biosynthesis of antibiotics
gka01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GK2344
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GK2344
Enzymes [BR:gka01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     GK2344
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     GK2344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored Shikimate_DH 3HCDH_N ApbA NAD_binding_11 2-Hacid_dh_C IlvN
Motif
Other DBs
NCBI-ProteinID: BAD76629
UniProt: Q5KXF7
Position
complement(2371796..2373205)
Genome map
AA seq 469 aa AA seqDB search
MAKQQIGVIGLAVMGKNLALNIESKGYSVAVYNRSREKTDEFLQEAKGKNIVGTYSIEEF
VNALEKPRKILLMVKAGAPTDATIEQLKPHLEKGDIVIDGGNTYFKDTQRRNKELAELGI
HFIGTGVSGGEEGALKGPSIMPGGQKEAHELVRPIFEAIAAKVDGEPCTTYIGPDGAGHY
VKMVHNGIEYGDMQLIAEAYFLLKHVLGMDAAELHEVFADWNKGELNSYLIEITADIFTK
IDEETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFLSAMKDERVKAS
KVLAGPAVKPFEGDRAHFIEAVRRALYMSKICSYAQGFAQMKAASEEYNWNLRYGDIAMI
FRGGCIIRAQFLQKIKEAYDRDPALSNLLLDPYFKDIVERYQDALREIVATAAMRGIPVP
GFASALAYYDSYRTAVLPANLIQAQRDYFGAHTYERVDKEGIFHTEWLK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacagcaaatcggcgtcatcggactggcggtcatggggaaaaacttggcgctc
aacatcgaaagcaaaggctattcggtggcggtgtacaaccgttcgcgcgaaaaaacggac
gagtttttgcaagaagcgaaaggaaaaaacattgtcggtacatacagcatcgaagaattc
gtcaacgccttggaaaaaccgcggaaaattttgctgatggtgaaagcgggcgcgccgacg
gacgcgacgatcgaacagctgaagccgcatttggaaaaaggcgatattgtaattgacggc
ggcaatacgtattttaaagatacgcagcgccgcaacaaagaactcgccgaacttggcatc
cactttattggcacgggcgtctcgggcggcgaggaaggggcgctgaaaggcccgtcgatc
atgccagggggccaaaaagaagcgcatgagctcgtgcgcccgatttttgaagccatcgcc
gccaaagtcgacggcgaaccgtgcacgacgtacatcggtccggacggcgccgggcattat
gtcaaaatggtgcacaacggcatcgaatacggcgacatgcagctgatcgctgaagcgtac
ttcttgctcaaacatgtgctcggcatggatgctgcagagctgcacgaagtgtttgccgac
tggaacaaaggcgagctgaacagctacttaatcgagatcacggccgacattttcacgaaa
atcgatgaagaaacaggcaagccgcttgtcgacgtcattttggacaaagccgggcaaaaa
gggacgggcaaatggacgagtcaaaacgccctcgatttgggcgtgccgctgccgatcatc
acggaatcggtgttcgcccgtttcctctcggcgatgaaagacgagcgcgtgaaagcaagc
aaagtgctggcaggcccagcggtgaagccgtttgaaggcgaccgcgctcacttcatcgaa
gcggtgcgccgcgcgctttacatgagcaaaatttgctcgtacgcccaaggatttgcgcaa
atgaaggcggcttctgaggaatacaactggaacttgcgctacggtgatatcgccatgatc
ttccgcggcggctgcatcatccgcgcgcaatttttgcaaaaaattaaagaggcgtacgac
cgcgatccggcgctttcgaacttgctcttggatccgtatttcaaagacattgtcgaacgc
taccaagacgcgctccgcgaaatcgtcgccaccgcggcgatgcgcggcattccggtgcca
ggattcgccagcgccctcgcctattacgacagctaccgcaccgcggtgctcccggccaac
ttaatccaagcgcagcgcgactacttcggcgcccacacgtacgaacgcgtcgacaaagaa
ggcattttccatacggaatggttgaaataa

DBGET integrated database retrieval system