KEGG   Geobacillus kaustophilus: GK2889Help
Entry
GK2889            CDS       T00217                                 

Definition
(GenBank) pyrroline-5 carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00250  Alanine, aspartate and glutamate metabolism
gka00330  Arginine and proline metabolism
gka01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GK2889
   00330 Arginine and proline metabolism
    GK2889
Enzymes [BR:gka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     GK2889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAD77174
UniProt: Q5KVW2
Position
complement(2913249..2914796)
Genome map
AA seq 515 aa AA seqDB search
MFTPYQHEPLTDFTVEKNQRAFQMALEEVSNHLGKEYLLVIGGKRITTTEKVVSINPANK
EEIVGIVSKADKRLADQAMEAALKAFETWRKEKPEARAHILFRAAAILRRRRHEFSAYLV
KEVGKPWKEADADTAEAIDFLEYYGRQMITLQHGVPVLSRPGERNTFHYIPLGVGLVISP
FNFPLAIMAGTTVAAIVTGNTVILRPSDRAPIVAAKFVEVMEEAGLPPGVLNYLSGGEAE
VGEYLVEHPKTRFISFTGSRAVGCRIYERAAIVQPGQKWIKRVIAEMGGKDAIIVDKDAD
LELAAQSIVVSAFGFSGQKCSACSRVIVLEDVYEQVLNRVVELTKQLIVGDPEKPSTFMG
PVIDETAYNKVMHYIDIGKQEGKLMTGGEGDSSKGFFIQPTVFANVDPNARIMQEEIFGP
VVAFTKAKDFDHALNIANNTEYGLTGAVISRNRPNFEKAREEFHVGNLYFNRGCTGAIVG
YQPFGGFNMSGIDSKAGGPDYLLLHMQAKTVSEAF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtttacaccttatcaacacgagccgttaacagattttactgtagagaagaaccaacgg
gctttccaaatggcattggaggaagtcagcaatcatttggggaaagagtatttacttgtc
attggagggaagcggattacgacaacggagaaagtcgtttccatcaatccggcaaataaa
gaagaaatcgtggggattgtttccaaagcggacaaacgactggccgatcaggcgatggag
gccgctctcaaggcgtttgaaacgtggagaaaagaaaaaccggaagcgcgtgcccatatt
ttattccgagcagctgcgattcttcgtagaaggaggcatgaattttccgcttacttagtg
aaagaagtggggaaaccgtggaaagaggcagatgccgatacagccgaagcaattgatttt
ctcgaatattacgggcggcaaatgattactttgcaacatggcgtccctgtattgagccgt
ccaggcgaacggaatacatttcactatattccattgggcgtcggtttagtcatttctccg
tttaattttccgctcgccattatggcaggcaccacggtcgctgccatcgtgacaggaaac
accgttattctccgtccatccgatcgagccccgatcgtagcggccaaatttgttgaagta
atggaggaggccggacttcctccaggtgtattgaattatttgtcgggcggcgaggcggag
gttggagagtaccttgtcgagcatccaaaaacgagatttatttcgttcaccggttctcgc
gccgttggttgccgcatttacgaacgagcggcgattgttcagcctggacaaaaatggata
aaacgagtcatcgctgaaatgggaggaaaagatgcaattattgttgataaagatgcagac
ttagaattagccgcacaatcgattgtcgtttcggcatttggattttccggtcaaaaatgt
tcggcgtgttctcgtgtcatcgtattggaagatgtgtacgagcaagtactaaaccgcgtt
gtggaattaacaaaacaactcattgtcggagacccggaaaaaccaagtactttcatggga
ccagttattgatgagactgcatataacaaagtgatgcattacattgatatcggcaaacaa
gaagggaaactgatgacaggcggtgagggcgatagttcaaaggggtttttcattcagccg
acggtgtttgccaatgttgatccgaatgcacgcatcatgcaagaggaaattttcggtccg
gtcgtggcgtttacgaaggcaaaagacttcgatcatgcgctgaatattgcgaataacacg
gaatacggtttaacaggtgcagttatctcacgaaatcggcccaactttgaaaaagcgcgg
gaggagtttcatgttggcaatctttacttcaaccgcggttgcaccggcgccatcgtcggc
tatcagccgttcggagggttcaatatgtccggcatcgattcaaaagctggcggccctgac
tatttgctccttcatatgcaagccaagacggtaagcgaagcgttttaa

DBGET integrated database retrieval system