KEGG   Geobacillus kaustophilus: GK2945Help
Entry
GK2945            CDS       T00217                                 

Definition
(GenBank) low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
gka  Geobacillus kaustophilus
Brite
KEGG Orthology (KO) [BR:gka00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    GK2945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: BAD77230
UniProt: Q5KVQ6
Position
complement(2974711..2975709)
Genome map
AA seq 332 aa AA seqDB search
MDTILILTICIVIFALAFDFINGFHDTANAIATSVSTRALTPRQAIILAATMNFIGALTF
TGVAKTITKDIVDPFALENGPLIILAALTSAIAWNLITWYYGIPSSSSHAIIGSVAGAAI
SAAGVGILNYGGFLKILQSLILSPFLALGVGFIIMSIFRFIFKNANLYSTTRGFRMFQIV
TAAFQAYTHGTNDAQKAMGIITMALIAGGYHATTDIPEWVRISAALAMGLGTAVGGWKII
KTVGGKIMKIRPINGAAADLSSALVILSATMFHLPVSTTHVISSAIMGVGAAQRVKGVKW
GVARRIVLTWIITLPVSALIAGFVYQVLRLFF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatacgatcctgattttaacgatctgcatcgtcattttcgcattggcgtttgacttt
atcaacggctttcacgatacggccaacgccattgccacatcggtgtcgacaagggcgctc
acgccgcgtcaagccattattttggctgcgacgatgaactttatcggcgcgctcaccttt
accggcgtcgcaaaaacgattacgaaagacattgtcgacccgtttgcgctagaaaatgga
ccactcattattttagcagcgttgacatcagccattgcctggaatttgatcacgtggtat
tacggcattccgagcagctcttcgcacgcgatcatcggttcggtcgccggagcggcgatt
tccgcggctggggttgggattttgaattacggcgggtttttgaaaattttacaatcgctg
attctttccccgtttttggcgttaggggtcggctttatcattatgagcatttttcgtttt
atctttaaaaacgccaacttatacagcacgacgaggggctttcggatgtttcaaattgtg
accgcggcgtttcaggcgtatacgcacggaacaaacgacgctcaaaaagcgatggggatc
attacgatggcgttaatcgccggaggataccacgcgacgaccgacattcctgaatgggtg
cgcatttctgccgccttggccatgggattgggaacggctgttggtgggtggaagatcatt
aaaacggtcggtggaaaaattatgaaaattcgtccgatcaacggagcggcggctgatttg
tcgtccgcactcgtcattctttcagcgacgatgttccacttgccagtcagcacgacgcac
gtcatttcctcggccatcatgggggtcggcgccgcccaacgggtgaaaggcgtcaaatgg
ggcgtcgctcgccgcattgtgctgacatggatcatcaccttgccagtgtcagcgttgatt
gctgggtttgtgtaccaggttctccgtttatttttctaa

DBGET integrated database retrieval system