KEGG   Geobacillus kaustophilus: GK2965Help
Entry
GK2965            CDS       T00217                                 

Definition
(GenBank) 2-hydroxyacid dehydrogenase
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00630  Glyoxylate and dicarboxylate metabolism
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GK2965
Enzymes [BR:gka01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     GK2965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN F420_oxidored Shikimate_DH NAD_binding_7 XdhC_C
Motif
Other DBs
NCBI-ProteinID: BAD77250
UniProt: Q5KVN6
Position
complement(2991835..2992809)
Genome map
AA seq 324 aa AA seqDB search
MTKPYVFITRKLPEDVVAPLLAIAEVEMWPHEDMAVPHDVLVEKAKRATAILPMVSDPID
EDVLSAGSALRVVANMGVGYDNIDVAAAAHRGILVCNTPDVLTDTTADLTFALLLATARR
LVEAAMFLKEGKWKSWSPFLLAGADVHHKTIGIVGMGNIGQAVAKRAKGFDMNILYYNRS
RRPEAEEKLGAVYRPFADLLSESDFVVCLTPLTSETRHLFNREAFRQMKKSAIFINAARG
AVVDEQALYEALVGGEIAAAGLDVFEHEPVAADHPLVSLPNVVALPHIGSATYETRRAMM
TLARDNIIAVLEGRPPLTPVNRIS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagccgtatgtattcattacgcgaaaattgcccgaggacgtggtcgcgccgctt
ttggccatcgctgaagtagagatgtggccccatgaagatatggccgtgccacacgatgtg
ctcgtggaaaaggcgaaacgggcgacggccatcttgccgatggtgtctgatccgatcgat
gaagacgtcttgtccgccggttcggcgctccgagtcgtcgccaatatgggcgtcggctac
gataacattgatgtagcggcggcggcccatcgaggcattctcgtttgcaatacacccgat
gtattgaccgatacgacggccgatttgacgtttgcgcttttattggccacagcccgccgc
cttgtcgaagcggctatgtttttgaaagaagggaaatggaaaagctggagtccgtttttg
cttgcgggcgccgatgtccatcataaaacgatcggcatcgtcggcatggggaacatcggc
caggcagtggcgaaacgggcgaaggggtttgacatgaacattctgtattacaaccgctcc
cgccgtccggaggcggaagagaagcttggcgccgtctatcgtccgttcgccgacttgctt
tcagagagcgattttgtcgtctgcttgacgccgctcacctccgagacgcgccatttgttc
aaccgcgaggcgttccggcaaatgaagaagtccgcgattttcattaacgcggcgcgcgga
gcggtcgtcgatgaacaggcgttgtatgaggcgctggtcggcggggagatcgccgcggcg
ggattggatgtatttgaacacgagccggtcgcggccgatcatccgctcgtttcgcttccg
aacgtcgtcgccttgccgcatatcggcagcgccacgtacgaaacgcggcgcgccatgatg
acattggcgcgcgacaatatcatcgccgtgctcgaaggacggccgccgctgacgcctgtg
aaccggatctcataa

DBGET integrated database retrieval system