KEGG   Geobacillus kaustophilus: GK3230Help
Entry
GK3230            CDS       T00217                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GK3230
Enzymes [BR:gka01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GK3230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin AAA_26
Motif
Other DBs
NCBI-ProteinID: BAD77515
UniProt: Q5KUX1
Position
complement(3265866..3266759)
Genome map
AA seq 297 aa AA seqDB search
MNKPTITVIGSLNMDLVTVAARFPNQGETILGEQFLTTPGGKGANQAVAAARLGANIRMI
GAVGDDAFGQELIRSLQNEGISVDYVKPVTHGSTGIASITISERDNRIIVVPGANHALTP
EDLDSCESVIAESDVCLLQLEIPLPVVERAVSIAHRHGVRVIVNPAPAQPLPPSVLEQAS
FLTPNEHERTILFDKMDEEAFADKLIVTEGAKGVRIWQDGQERLIPSFQVPVVDTTGAGD
TFNGALAVALAEGKPLDEACRFANAAAALSVTKLGAQAGMPRRQEVESFLSRQKESH
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaaccaaccattacggtgatcggcagcctcaacatggacttagtcactgtggcg
gcgcgatttccaaaccaaggagagacgattttaggcgaacagtttctcaccactcccggc
ggcaaaggggcgaatcaggcggtggcagccgcccgcctcggcgccaacattcggatgatt
ggcgcagtgggggatgatgcgtttggtcaagagctcatccgttcgttacaaaatgagggc
atttccgtcgattatgtgaaaccggttacacatgggagtacaggcattgcttccattacg
atttctgagcgggacaatcggatcatcgtcgttcctggggcgaatcatgcgcttacgccg
gaagatctcgattcatgtgaatccgtgatcgccgaaagcgatgtttgcttattgcagctc
gagattccgcttcccgttgtggaacgggcggtttcgatcgctcatcgccatggcgtgcgc
gtcatcgtcaaccccgctccggcccagccgctgccgccgtcggtgcttgagcaggcgagt
ttcttgacgcccaatgaacatgaacggacgattttgttcgacaagatggacgaagaagcg
tttgccgataagctgattgtcaccgaaggggcaaaaggggtgcgcatttggcaagatgga
caagaacggctcattccaagtttccaagttcccgtcgtggatacgacgggcgcgggcgat
acgtttaacggtgcgcttgccgtggcgttggcagaagggaagccgcttgatgaagcgtgt
cggtttgccaatgcggcggcggccttgtcggtgacgaaacttggggcgcaagctgggatg
ccgagacggcaagaggtcgaatcatttttgtccagacagaaggagagtcactga

DBGET integrated database retrieval system