KEGG   Geobacillus kaustophilus: GK3397Help
Entry
GK3397            CDS       T00217                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00071  Fatty acid degradation
gka00072  Synthesis and degradation of ketone bodies
gka00280  Valine, leucine and isoleucine degradation
gka00310  Lysine degradation
gka00362  Benzoate degradation
gka00380  Tryptophan metabolism
gka00620  Pyruvate metabolism
gka00630  Glyoxylate and dicarboxylate metabolism
gka00640  Propanoate metabolism
gka00650  Butanoate metabolism
gka00900  Terpenoid backbone biosynthesis
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01120  Microbial metabolism in diverse environments
gka01130  Biosynthesis of antibiotics
gka01200  Carbon metabolism
gka01212  Fatty acid metabolism
gka02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GK3397
   00630 Glyoxylate and dicarboxylate metabolism
    GK3397
   00640 Propanoate metabolism
    GK3397
   00650 Butanoate metabolism
    GK3397
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GK3397
   00072 Synthesis and degradation of ketone bodies
    GK3397
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GK3397
   00310 Lysine degradation
    GK3397
   00380 Tryptophan metabolism
    GK3397
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GK3397
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GK3397
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GK3397
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gka04147]
    GK3397
Enzymes [BR:gka01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GK3397
Exosome [BR:gka04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GK3397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF2496 SpoVAD
Motif
Other DBs
NCBI-ProteinID: BAD77682
UniProt: Q5KUF4
Position
complement(3438005..3439183)
Genome map
AA seq 392 aa AA seqDB search
MGKTVIVSGARTPFGKLGGSLQALSASELGGIAVKEALARADVSVEQVDHVILGTVLQGG
QGQLPSRQAMRHAGIPWHVRTETVNKVCASGMRAVTLADQLIRLGDADVVVAGGMESMSN
APYVLPKARWGLRMGDSTVKDLMVYDGLTCSFTGVHMGVYGGNTARELGITREAQDEWAY
RSHMRAIAAIEAGRLAEEIVPVTIPQRKGEPLVVEHDEAPRKDTSLEALAKLPPVFDPEG
TITAGNAPGVNDGAAALVLMSEERAAREGLEPLATVVAHTAIAVEAKDFPKTPGLVINEL
LRKTGKTVDDIALFEINEAFAAVALAAIQIAGLDPEKVNVNGGAVALGHPIGASGARIIL
TLIYELKRRGGGLGIAAICSGGGQGDAILVEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaacagtgattgtcagcggggcgcgcaccccgttcggaaaactcggcggttct
ttgcaagcgctgtcagcgtcagaactcggcggcattgccgtgaaagaagcgcttgcccgc
gcggatgtgagcgtggaacaagtcgatcatgtcattttaggcaccgtcttgcaaggcgga
caaggacagctcccatcgcggcaggcgatgcgccatgccggcattccgtggcatgttcgc
accgagacggtcaataaagtatgcgcatcgggcatgcgcgccgtgacgctcgcggatcag
ctcatccgcttaggcgacgccgatgtcgttgtcgcgggcgggatggaatcgatgagcaac
gccccgtacgtgctgccgaaagcgcgctgggggttgcgaatgggcgacagcacggtgaag
gatttaatggtgtatgatggcttgacatgcagttttaccggcgtccatatgggcgtttat
ggcgggaatacagcgcgtgaacttggcattacacgcgaggcgcaggatgagtgggcgtac
cgcagccatatgcgagccattgccgccatcgaagccggtcggctcgcggaagagatcgtt
ccggtgacgattccgcagcgcaaaggagagccgcttgtcgtcgaacacgacgaggcgccg
cgcaaagacacgtcgcttgaagcgttggcgaaactgccgccggtgtttgacccggaagga
acgatcactgccggcaacgccccgggcgtcaacgacggcgccgcggcgctcgtcttgatg
agcgaggagcgcgccgcccgcgaggggcttgagccgctcgcgactgttgtcgcccacacc
gccatcgccgttgaggcgaaagatttcccaaaaacgccgggacttgtcatcaacgagctg
ctccgcaaaacgggaaaaacggtcgacgacattgccttgttcgaaataaacgaagcgttt
gccgctgttgctcttgctgcgatccaaatcgccggccttgacccggaaaaagtgaacgtc
aacggcggcgctgtcgccctcggccacccgatcggcgcgagcggcgcacgcatcatcctc
acgctcatttatgagctgaaacgccgcggcggcggcctcggcatcgccgccatctgcagc
ggcggcggccaaggcgacgccatcttggtcgaggtataa

DBGET integrated database retrieval system