KEGG   Giardia lamblia: GL50803_104150Help
Entry
GL50803_104150    CDS       T01047                                 

Definition
(RefSeq) Kinase, PLK
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
gla  Giardia lamblia
Brite
KEGG Orthology (KO) [BR:gla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gla01001]
    GL50803_104150
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gla03036]
    GL50803_104150
Enzymes [BR:gla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     GL50803_104150
Protein kinases [BR:gla01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   GL50803_104150
Chromosome and associated proteins [BR:gla03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     GL50803_104150
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    GL50803_104150
  Sister chromatid separation proteins
   Polo kinases
    GL50803_104150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Kinase-like Pkinase_fungal Ldl_recept_b
Motif
Other DBs
NCBI-GeneID: 5698661
NCBI-ProteinID: XP_001705776
UniProt: A8BPK8
AA seq 678 aa AA seqDB search
MSHSNAPELHPQIVDPFHNVTYRPGKLLGKGGFAYVYEFHDVNSDSSYACKITPRSALQK
KKYYDKFVTEVTIHRGLVHPNICRVLNVFKDQMNYYIILEKCNGGTLTDLIRRRKHLTET
EARFFSKRILNALWYLHDLYIIHRDIKTSNIFLMEDFDVKVGDFGLAVKCETPEELHWTM
CGTPNFLPSEVIYSHIMKRKASGRGPDPNLDEDCVNLCHQLLPAYSGQGHSFSADMWSFG
CLVFSMIYGRPPFEAADIKTTYKRIVRCDFSFPGSISVSEDLKNFIKGLLTPDPRKRFTV
KECLDHSWLNPSKYFIPESLPPRIISEPYEVPPLCSASPTRNMQMTINMAKNAGGTDGRF
IAATPQAIGGTEHIPTPGTANFYKPQNAILTTKSAAGISRASTAMAMQNVGSAQGVVNKY
GINEAEYPQIDPPCYIMSWVDYSNRYGFAYQISNGSIGVIFNDESAAILSPNALIVDYSP
SLLDAAFDRALFEEGTTILSEKKFKLLSFFRDYLENRSIVPIPAADRPKEDEELKRVIEQ
ERMNNQEIDFKRLTKGLPLPQLFLKKWKLYDDGTLCLLFNTKVFQVNFADHSKVVVAHRS
VTFMSEKREIYTYPSEYLKDDRFSFKELRRRVDRARKYYEIIKAARPVDSLAQYRYNKDS
TKKSASGSSTRQLGQGGE
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacagcaacgccccagaactgcatcctcagatcgtggacccctttcacaacgtg
acctaccgtcccggaaaactactaggaaaaggcggctttgcatacgtttacgagttccac
gacgttaactctgactcctcctacgcctgcaaaattactccacgctcggctctccagaag
aagaagtactatgataagttcgtgacggaagtcaccatccaccgggggcttgttcacccc
aacatttgtagagttctgaatgtctttaaggatcaaatgaactactacattattcttgaa
aagtgtaatggaggtacattgacagatctcatcaggcggcggaaacacctcacagaaaca
gaagcacgcttcttcagcaagcgtatcctcaatgctctttggtatctccacgacctctac
attattcatcgggacattaagacgtcgaatatttttttgatggaagacttcgacgtgaag
gttggggactttgggcttgcagtcaagtgcgaaactccagaggagctgcactggaccatg
tgtggaacgccaaactttctcccctcagaggtcatatattcgcacataatgaaacgcaag
gctagcgggcgtggtccagacccgaacttggacgaggactgcgtaaatctctgtcaccag
cttcttccagcgtattcgggtcaggggcacagtttttcggctgatatgtggtcatttggc
tgtcttgtcttttcaatgatatatggtaggcccccatttgaagccgcggacatcaagacg
acctacaagcgcatcgttcgttgcgatttttctttcccaggctccatctctgtgagtgaa
gacctcaagaacttcatcaaaggcctgctaactccagatccccgcaagcggtttaccgtc
aaggagtgcttggaccactcatggcttaatccgtccaagtactttatcccagagagccta
ccaccaaggatcatatcggaaccctacgaagttccacctctgtgctctgcgtcaccgact
cgcaacatgcagatgactatcaacatggccaagaacgccggaggaacggatggtcgtttc
attgcagccactccgcaggccattgggggtaccgagcacataccaactcctgggaccgca
aacttttacaagcctcaaaatgcaatacttacgaccaagagcgcagcaggcatctctcgc
gctagcacagcgatggccatgcagaacgttggatctgcacagggtgtggtcaataagtat
ggcatcaatgaagccgagtatccacaaatagacccaccgtgctacatcatgtcctgggtg
gactattccaaccggtatgggtttgcctaccagatcagcaacggcagcatcggcgtgata
tttaacgatgaatcggctgcgattctctctcccaacgctctcatcgttgactattctccg
tctctcctagacgctgcctttgacagggccttgttcgaagaggggactaccattctctcg
gagaagaagttcaagctcttgtccttctttagagactaccttgaaaataggtctattgtg
cccattccagcagccgatcgtcccaaggaggatgaggagctgaagagggtcattgagcaa
gagcgcatgaataatcaagagatagacttcaagcgactgacaaaagggcttcctctgcca
cagctcttccttaagaagtggaagttgtacgatgacggcactctttgccttctattcaat
accaaggtgtttcaggttaacttcgctgaccattccaaggtggttgtcgcgcaccgaagc
gtcacgtttatgagcgagaagcgcgagatatacacatatccttctgagtacttgaaggac
gacaggttctcattcaaggagcttcgtcgtagagttgacagggcaaggaagtactacgag
atcattaaggcggcaaggcctgttgattccttggcacagtacagatataacaaggattct
acgaagaaaagcgcctctggctcctccacaaggcagctcggtcagggaggggaatag

DBGET integrated database retrieval system