KEGG   Giardia lamblia: GL50803_10521Help
Entry
GL50803_10521     CDS       T01047                                 

Definition
(RefSeq) Arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
gla  Giardia lamblia
Pathway
gla00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gla00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GL50803_10521
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gla01007]
    GL50803_10521
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gla03016]
    GL50803_10521
   03029 Mitochondrial biogenesis [BR:gla03029]
    GL50803_10521
Enzymes [BR:gla01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     GL50803_10521
Amino acid related enzymes [BR:gla01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   GL50803_10521
Transfer RNA biogenesis [BR:gla03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GL50803_10521
 Prokaryotic type
   Other AARSs
    GL50803_10521
Mitochondrial biogenesis [BR:gla03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GL50803_10521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e tRNA-synt_1 tRNA-synt_1g
Motif
Other DBs
NCBI-GeneID: 5701435
NCBI-ProteinID: XP_001708522
UniProt: A8B9N2
AA seq 621 aa AA seqDB search
MEDLKDICAQAMHTVLGDHIAPLSAQEGWKESMLGVFTSPLVTPTTNIKYGHYQFNSTMG
IAKLIKDLHYDALPSNPAELSGLFTQAMLCVQDKYAEEKGCPKPIEAVNIAGCFINIALT
PAYLLSKCFDIYMAVPFGTLPKPPTLPRKRVVVDFSSPNVAKSMHVGHLRSTIIGDSICR
LYEYVGYDVHRINHVGDWGTQFGMLITHLTDMHPEIADAAAHCRRITMLPIDNLVAFYKA
AKERFDNDPAFQKRAYEAVVKLQRLNLAEFYLWCKICDISRHEFQRIYDRLDIKIDEFGE
SSYKFKLGTTVARLKRLHLTQMSDKATVIPIEGMDYPLIIVKSDGGFTYDTTDMAAIYHR
TQVLHADKCVYVVDAGQSSHFDLVFKAAEKAGWITKDQAVHVPFGVVLGSDGKRLKTRAG
ETVKLEDLLDEAVTESMRLLEERNRDQEFSQEEMRQVAEAVGYGAVKYADLSSHRIKDYK
YDPKRMLNLKGNTAAYLLYSFTRISSICRKAGIDREELYTSDTLRNLSITEPSEINLLVA
LLKVRDTILFTLEDLCPHRICDWVYSVASAYTDFYEKCRVIETSASGDSVCNKSRLVLCE
MARQSLRLAFHLLGIREIDRM
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggaggacctcaaggacatatgcgcccaggccatgcacaccgttcttggagatcacatt
gcccctctctcggctcaggaaggctggaaggagagcatgctcggcgttttcacgtcccct
cttgtcacgccgaccacaaacattaagtacgggcactatcagttcaacagcacgatgggc
attgctaagcttatcaaggatcttcactacgatgcactcccgtcaaatcctgccgaactg
tctggtctcttcactcaagcaatgctttgtgtccaagacaaatatgcagaggaaaagggg
tgccccaagcccatagaggcagttaatatagcaggctgcttcataaacattgcactcacc
cctgcatatttgctttcgaagtgctttgacatctacatggccgtgccgtttgggactctg
ccaaagcctcccactctacccagaaaacgcgttgtcgtcgacttttcgtcacctaacgtg
gcaaagtctatgcacgtgggtcacctgcgatcaacgattatcggggactctatttgccgt
ctctatgagtatgtggggtatgacgtccaccgcatcaaccacgtgggcgactggggcacg
cagttcggcatgctcatcactcacctaacggatatgcatccagagatagctgatgctgcg
gctcactgcaggcgcataacaatgcttccaatcgacaaccttgtggccttctacaaagca
gcaaaggagagatttgacaacgatccagccttccagaagcgggcctatgaggctgttgtc
aagctacaacgcctcaacttggcagagttttacctctggtgcaagatttgtgacatctct
aggcacgagtttcagcgcatttatgatcgcctagacatcaagattgatgagtttggagag
agttcctacaagttcaagctgggcaccactgtcgcgcggttgaaaaggctccacttgact
cagatgtccgacaaggcaactgtcataccaattgaggggatggactatcctctcatcatc
gtcaagtccgacggcggctttacttacgacacaacagacatggcagctatttatcaccgc
acccaggtccttcacgcggacaagtgcgtgtacgttgttgacgccggccagtcgagtcac
tttgatcttgttttcaaagctgctgagaaggctggctggatcacaaaggaccaggccgtg
cacgtcccattcggggttgtgctcggaagcgatggcaagcgcctcaaaacaagagcagga
gagaccgttaagctggaggatttgctcgatgaggcggtcacggagtccatgcggctcctt
gaggagcgcaaccgtgaccaagagttcagccaagaggaaatgcgccaggttgcagaggct
gtcggctacggagctgtcaaatatgctgacttgtcctctcacaggattaaggactataag
tatgaccctaagcgaatgctcaatctgaaaggaaatactgcggcatacctgttgtatagc
tttacgcgaatctcgtctatctgtcgcaaagccggaatcgatcgggaagagctctacacc
agtgacactctcaggaacttgtctatcacagaaccctctgaaattaatctcttagttgcg
ctgttgaaggtccgtgataccattctatttactctagaagatctgtgtccgcaccgtatt
tgtgactgggtgtactctgtagcctccgcgtacacagacttctatgaaaagtgccgagtc
attgagacttctgcgtctggggacagcgtctgcaacaaatctcgtcttgtcctgtgtgaa
atggcccgtcagagcctccgcctggcattccacttgcttggaatccgtgagatcgacaga
atgtga

DBGET integrated database retrieval system