KEGG   Giardia lamblia: GL50803_93938Help
Entry
GL50803_93938     CDS       T01047                                 

Definition
(RefSeq) Triosephosphate isomerase, cytosolic
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gla  Giardia lamblia
Pathway
gla00010  Glycolysis / Gluconeogenesis
gla00051  Fructose and mannose metabolism
gla00562  Inositol phosphate metabolism
gla01100  Metabolic pathways
gla01110  Biosynthesis of secondary metabolites
gla01130  Biosynthesis of antibiotics
gla01200  Carbon metabolism
gla01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GL50803_93938
   00051 Fructose and mannose metabolism
    GL50803_93938
   00562 Inositol phosphate metabolism
    GL50803_93938
Enzymes [BR:gla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GL50803_93938
Exosome [BR:gla04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GL50803_93938
  Exosomal proteins of bladder cancer cells
   GL50803_93938
  Exosomal proteins of melanoma cells
   GL50803_93938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM LemA
Motif
Other DBs
NCBI-GeneID: 5699725
NCBI-ProteinID: XP_001706830
UniProt: A8BIF2
Structure
PDB: 

AA seq 257 aa AA seqDB search
MPARRPFIGGNFKCNGSLDFIKSHVAAIAAHKIPDSVDVVIAPSAVHLSTAIAANTSKQL
RIAAQNVYLEGNGAWTGETSVEMLQDMGLKHVIVGHSERRRIMGETDEQSAKKAKRALEK
GMTVIFCVGETLDERKANRTMEVNIAQLEALGKELGESKMLWKEVVIAYEPVWSIGTGVV
ATPEQAEEVHVGLRKWFAEKVCAEGAQHIRIIYGGSANGSNCEKLGQCPNIDGFLVGGAS
LKPEFMTMIDILTKTRT
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctcgtcgccccttcatcggcggtaacttcaagtgtaacggctctcttgacttt
atcaagagccacgtggcggcaattgctgcccataagatccctgattccgtggacgtcgtc
attgccccttccgccgtacacctgtcaacagccattgcggcaaacacgtcaaaacagttg
aggatagcagcgcagaatgtgtacctagaggggaacggggcgtggactggcgagacaagt
gttgagatgcttcaggacatgggtttgaagcatgtgatagtagggcactctgaaagacgc
agaatcatgggggagaccgacgagcaaagcgccaagaaggctaagcgtgccctggaaaag
gggatgacggtcatcttctgcgtcggagagaccttggacgagcgcaaggccaaccgcacc
atggaggtgaacatcgcccagcttgaggcgcttggcaaggagctcggagagtccaagatg
ctctggaaggaggttgtcattgcttacgagcccgtgtggtccattggcacgggcgtggtg
gccacgcccgagcaggcagaggaggtccatgtggggctccgaaagtggtttgcggagaag
gtttgtgccgagggcgcacagcatatccgtatcatttacgggggatcggccaatggaagc
aactgcgagaagcttggccagtgtccgaatattgacggcttccttgtcggtggcgcttcc
ctcaagccggagtttatgacgatgatcgacattcttacgaagacccgtacatag

DBGET integrated database retrieval system