KEGG   Giardia lamblia: GL50803_9698Help
Entry
GL50803_9698      CDS       T01047                                 

Definition
(RefSeq) Riboflavin kinase, FMN adenylyltransferase
  KO
K00861  riboflavin kinase [EC:2.7.1.26]
Organism
gla  Giardia lamblia
Pathway
gla00740  Riboflavin metabolism
gla01100  Metabolic pathways
gla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    GL50803_9698
Enzymes [BR:gla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     GL50803_9698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavokinase
Motif
Other DBs
NCBI-GeneID: 5697499
NCBI-ProteinID: XP_001704611
UniProt: A8BVC6
AA seq 138 aa AA seqDB search
MIFCTKGTVVRGFQRGRVINFKTANLVLSNQDQLEDGVFSGWARVELSGDVLPAVISYGK
NPTFANKSKTLEVHILATFPEDFYGATLYTTIQRRLRSPIKFSGIEELNAQIKMDIENAQ
VDYTEENRKKAELLFEGL
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgatcttttgcacaaaggggacggtcgtgaggggcttccagcgaggccgggtgattaat
ttcaaaacagccaacctcgtcttatcaaatcaggatcaactagaagacggggtctttagc
ggctgggcgcgtgtggaattaagcggagacgttctccccgcagtcatttcatacggtaag
aaccccacatttgctaataaaagcaaaacgttggaggtgcacattctcgctacgttcccc
gaggacttttatggagccactttatacacaactatccagcgccgcctccgctctcctata
aaattttccggcattgaagagcttaatgcgcaaattaaaatggatatagagaatgctcag
gtagattatacagaggaaaataggaagaaagcagagcttcttttcgagggcttataa

DBGET integrated database retrieval system