KEGG   Glaesserella sp. 15-184: CJD39_08660Help
Entry
CJD39_08660       CDS       T05643                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
gle  Glaesserella sp. 15-184
Pathway
gle00564  Glycerophospholipid metabolism
gle01100  Metabolic pathways
gle01110  Biosynthesis of secondary metabolites
Module
gle_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:gle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJD39_08660 (psd)
Enzymes [BR:gle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CJD39_08660 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AUI66638
Position
complement(1834773..1835669)
Genome map
AA seq 298 aa AA seqDB search
MELKSYPSPSYAQRAKIAFQYMMPQLYLTQAAGWLAERKWGVVTHLIIKLFAKKYQVNLS
EAEKTAASDYASFNEFFIRPLKENARPINQDPQALCLPADGRVSELGSIEENQLLQAKGH
QFSLETLLANDMPLAEKFKNGTFITTYLSPRDYHRVHMPCDATLRKMIYVPGELFSVNPF
LAEHVPNLFARNERVICEFETAFGPMVQILVGATITASMSTVWAGVVNPPRAKEVTVYEY
LTTGETAVHLKKGEEMGAFRLGSTVINLFPKGAVELEAHLKAGEPTRMGERLGKINFS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggaactaaaatcttatccatcaccaagttatgcacaacgtgccaaaattgcttttcaa
tatatgatgccacagctgtatttaacacaagcagccggttggttagcagagcgtaaatgg
ggcgtagtcactcatttaatcatcaaattatttgcgaaaaaatatcaagttaatctttct
gaagcagagaaaacagcggcttcagattatgcttcttttaatgaattttttattcgtcca
ttaaaagagaatgcgcgtccaattaatcaagatcctcaagctctttgtttgcctgcagac
ggacgtgtaagcgaattaggttctattgaagagaaccaattattacaagcaaaaggccat
caatttagcttagaaactttattagcaaatgatatgccattggctgaaaaattcaaaaac
gggacttttattactacgtatttatcgccaagagattatcaccgtgtccatatgccgtgt
gatgccacattacgcaaaatgatttatgtgccaggcgaactcttttcggtaaatcctttc
ttagcggaacatgtaccaaatctttttgcccgtaacgagcgtgtaatttgtgagtttgaa
acggcatttggtcctatggtacaaattttagtgggggcaactattacggcaagtatgagt
accgtttgggctggtgtggtcaatccgccgagagcgaaggaagtcactgtttacgaatat
ctcactacaggtgaaacagccgttcatttgaaaaaaggcgaagaaatgggggcgttccgt
ttaggatctactgtgattaacttattcccgaaaggcgctgttgagttggaagctcattta
aaagcaggtgaaccgacaagaatgggagagcgtttggggaaaattaatttctcatag

DBGET integrated database retrieval system