KEGG   Glaesserella sp. 15-184: CJD39_09395Help
Entry
CJD39_09395       CDS       T05643                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
gle  Glaesserella sp. 15-184
Pathway
gle00540  Lipopolysaccharide biosynthesis
gle01100  Metabolic pathways
Module
gle_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:gle00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CJD39_09395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:gle01005]
    CJD39_09395
Enzymes [BR:gle01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     CJD39_09395
Lipopolysaccharide biosynthesis proteins [BR:gle01005]
 Unusual sugar
  CJD39_09395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR
Motif
Other DBs
NCBI-ProteinID: AUI66775
Position
complement(1981998..1982924)
Genome map
AA seq 308 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNAIGRTDILVVDNLKNGEKFVNLVDLDIADYCDKEDFIASI
IAGDDFGPIDAIFHEGACSATTEWDGKYLMQNNYEYSKELLHFCLDRQIPFFYASSAATY
GGRSDNFIEDRKFEQPLNVYGYSKFLFDEYVRKILPDAESPVCGFKYFNVYGPREQHKGS
MASVAFHLNNQILKGENPKLFEGSETFLRDFVYVEDVAQVNLWAWQNGISGIFNLGTGNA
ESFRAVADAVLAFHQKGQIETIPFPDHLKSRYQTFTQADLTKLRAAGYDKPFKTVAEGTK
AYMEWLNR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgattattgtaaccggcggtgctggctttatcggcagcaacattgttaaggcgttaaac
gctatcgggcgaaccgatattttagtggtggataacctaaaaaacggtgagaaattcgtc
aatttggtcgatctggacatcgctgactattgcgataaagaagactttattgcgtctatt
attgcaggcgatgattttggtcctatcgatgcgatttttcacgaaggggcttgttccgcc
acaacggagtgggacggcaaatacttaatgcagaacaactacgaatactcaaaagagttg
ttgcatttctgcttagatcgccaaattccgtttttctatgcatcaagtgcagcgacctac
ggcggacgttcggacaactttattgaagatcgcaaatttgagcagccactcaatgtttat
ggctactctaaattcttgtttgatgaatatgtgcgtaaaattctgcctgatgccgagtcg
ccagtgtgtggctttaaatacttcaatgtctatggaccgcgtgaacagcacaaaggctca
atggcaagtgtggcattccatttgaataatcaaattttaaaaggcgaaaatccgaaactg
tttgaaggctcggaaacgttcttgcgtgattttgtctatgtggaagatgtagcacaggtg
aacctttgggcgtggcaaaacggtatttcgggtattttcaatcttggtacgggcaatgca
gaatcgttccgcgctgttgctgatgcggtgttggcgttccaccaaaaagggcagattgaa
acaatcccattccctgatcatctcaaatctcgctaccaaacctttacccaagcagattta
accaaactgcgtgcggcaggttatgataaaccattcaaaactgtcgccgaagggacaaag
gcgtatatggagtggctgaatagataa

DBGET integrated database retrieval system