KEGG   Geobacillus lituanicus: GLN3_00415Help
Entry
GLN3_00415        CDS       T05193                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
gli  Geobacillus lituanicus
Pathway
gli00020  Citrate cycle (TCA cycle)
gli00620  Pyruvate metabolism
gli01100  Metabolic pathways
gli01110  Biosynthesis of secondary metabolites
gli01120  Microbial metabolism in diverse environments
gli01130  Biosynthesis of antibiotics
gli01200  Carbon metabolism
Module
gli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GLN3_00415
   00620 Pyruvate metabolism
    GLN3_00415
Enzymes [BR:gli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     GLN3_00415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO TPP_enzyme_M NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ASS88593
UniProt: A0A223E059
Position
86642..88147
Genome map
AA seq 501 aa AA seqDB search
MGNKQGKTDVILIGAGIMSATLGTLLKELAPEWDIVVFERLEEAGAESSNEWNNAGTGHA
ALCELNYTVEKADGSIDIGKAIKINEQFYVSLQFWAYLVNSGILRDPKDFVRPLPHMSFV
QGEDNVAFLKKRHETMAANPLFKGMEFTDDPKKLAEWVPLMMEGRVVDEPIAATRIESGT
DVNFGALTRQLFEHLKRKNVEIRYRHHVEDIQRTSDGLWELRVRNLDTGAVELHAAKFVF
IGAGGGSLHLLQKSGIPEGKGIGGFPVSGLFMVCNNPEVVEQHHAKVYGKAKVGAPPMSV
PHLDTRFIDNQKMLLFGPFAGFSPKFLKNGSMLDLFTSIKPHNVLTILAAGVKNMSLTNY
LIQQVLLSKEQRMQELREFVPTAKSDEWDIVVAGQRVQVIKDTEAGGKGTLQFGTEVVHA
ADGSIAALLGASPGASTAVHVMLEVMEKCFPERMNEWRAKVKEMIPSYGESLMKNEALLR
QVQASTAEALGLNGHFAMQLA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaaacaaggaaaaacggatgtcattttaatcggcgcgggcattatgagcgcg
acgttggggacgctgctcaaggaattggcgcccgagtgggacattgtcgtctttgaaaga
ctggaagaggcaggagcggaaagctccaacgagtggaacaacgccgggacggggcatgcg
gcgctgtgtgagttgaactatacggttgagaaggccgatgggtcgatcgacatcggcaaa
gcgattaaaatcaatgagcagttttacgtctctttgcagttttgggcttatttggtcaac
agtggtattcttcgtgacccaaaagatttcgtccgtccgctgccgcatatgagctttgtg
caaggggaagacaatgtggcgtttttgaaaaagcggcatgaaacgatggcggccaatccg
ctgtttaaagggatggagttcacagatgatccgaaaaagttggccgaatgggtgccgctc
atgatggaagggcgggtggtggacgagccgatcgcggcgacgcggatcgaatcggggacg
gacgtgaacttcggggcgttgacgcgccaactgtttgaacatttgaaacggaagaacgtg
gagatccgctaccgccatcatgtcgaggatatccaacggacaagcgatggcttatgggag
ctgagagtgcggaatttggacacgggcgcggtggagcttcatgcggccaagttcgtcttc
atcggcgccgggggaggcagcctccatctgttgcaaaagtccggcattccggaagggaag
ggaatcggcggcttcccggtgagcgggttgtttatggtgtgcaacaatcccgaggtcgtc
gagcagcaccatgcgaaagtgtacggcaaagcgaaagtcggcgcgccgccgatgtcggtg
ccgcatttggacacgcggtttatcgacaatcaaaagatgctgctgtttgggccatttgcc
gggttttcgccgaagtttttgaaaaacggatcgatgctcgacttgttcacctcgatcaag
ccgcataacgtcttgacgatcttggcggcgggcgtgaaaaacatgtccttgaccaactat
ttgatccagcaagtgctgttgtcgaaagaacagcgcatgcaagagctgcgggaattcgtc
ccgacggcaaaaagcgacgagtgggacatcgtcgtcgctggtcagcgcgtgcaagtgatc
aaagacacggaagctggcggcaaaggaacgctgcagtttggcacggaagtcgtccatgcg
gccgatggctcgatcgcggcgttgctcggcgcgtcgccaggcgcatcgacggcggttcat
gtcatgcttgaagtgatggagaagtgcttcccagaacggatgaacgaatggcgggcgaaa
gtgaaagagatgattccgtcttacggcgagtcgttgatgaaaaacgaagcgctgttgcgg
caagtgcaagcatccacagccgaagcgctcggattgaacggccactttgcgatgcagttg
gcgtag

DBGET integrated database retrieval system