KEGG   Geobacillus lituanicus: GLN3_01060Help
Entry
GLN3_01060        CDS       T05193                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
gli  Geobacillus lituanicus
Pathway
gli00620  Pyruvate metabolism
gli00630  Glyoxylate and dicarboxylate metabolism
gli01100  Metabolic pathways
gli01110  Biosynthesis of secondary metabolites
gli01120  Microbial metabolism in diverse environments
gli01200  Carbon metabolism
Module
gli_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GLN3_01060
   00630 Glyoxylate and dicarboxylate metabolism
    GLN3_01060
Enzymes [BR:gli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     GLN3_01060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ASS85839
UniProt: A0A223DS57
Position
218169..220352
Genome map
AA seq 727 aa AA seqDB search
MADYVQVGTIQVAKVFYEFVNGELLPNSGLDQDKFWRDFAALIADLTPRNKELLARRDEI
QQQLNEWHKAHRGRFNFDEYKAFLTEIGYLEPEVEDFEITTENVDDEIAMQAGPQLVVPL
TNARYALNAANARWGSLYDALYGTDAISEEDGASRGSSYNPVRGAKVIAYGRKFLDEAVP
LAEYSHQDAVQYAVVDGRLVVTVEGGATTGLKEPEKFVGFQGDPQHPTAVLLKNNGLHIE
IQIDREHPVGKTDKAGIKDIVLEAAVTTIMDGEDSVAAVDAEDKVLVYRNLFGLIKGDLT
ATFEKNGKLMTRALNPDRVYETPDGGKLVLPGRSLMFVRNVGHLMTNNAILHANGEEVHE
GIIDAVITSLIMKHSLIGNTRYLNSRKGSIYIVKPKMHGSAEVAFANELFDRVEDMLGLE
RNTIKIGVMDEERRTSLNLKNCIYQVRDRIVFINTGFLDRTGDEIHTSMEAGPMLRKNEM
KSSTWLQAYEKSNVAVGLAAGFRGRAQIGKGMWAMPDLMAEMLKQKGAQLKAGANTAWVP
SPTAATLHALHYHQVNVAAVQSELANERADYRDDILQIPVVDNPQWTAEEIQEEIDNNCQ
SILGYVVRWVDQGIGCSKVPDIHNIGLMEDRATLRISSQILANWLHHGICTKEQVLEALK
RMAKVVDEQNAGDPNYRPMAPNYDDSVAFQAACDLVFLGYEQPNGYTEPILHRRRQEAKA
KFAAVQP
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggctgattacgtacaagtcgggacgattcaagtggcgaaagtgttttatgagtttgtc
aacggggagctcctgccgaacagcgggctcgaccaagacaagttttggcgcgattttgcc
gcgctcatcgccgatttgacgccgcgcaacaaagagctgctggcgcgccgcgatgagatc
cagcaacaattgaatgagtggcacaaagcgcaccgcggccgcttcaattttgacgagtat
aaagcgtttttaaccgaaatcggctatttggagccggaagtcgaggacttcgaaattacg
acagaaaatgtggatgatgaaattgccatgcaggccgggccgcagctcgtcgtgccgctc
acaaacgcccgctatgcgctgaacgccgccaatgcccgctggggcagcttatatgacgcg
ctgtacggcaccgacgccatcagcgaagaagacggcgcctcacgcggttcatcgtacaac
ccggtgcgcggggcgaaagtcatcgcctacggacggaagtttttggatgaggcggtgccg
cttgccgaatattcccatcaagacgcagtccaatacgcggtcgtggacgggcggctcgtc
gtgacggttgaaggaggggcgacgacagggctgaaagagccggaaaaattcgtcggcttc
caaggcgacccgcaacatccgacagcggtgttgctgaagaacaatggtcttcacattgaa
attcaaatcgaccgcgagcatccggtcggcaaaacggacaaagccggcattaaagacatt
gtgctcgaagcggcggtcacaacgatcatggacggcgaagattcggtggcggccgttgat
gccgaagacaaagtgcttgtctaccgcaacttgttcggcctcatcaaaggcgatttgacg
gcgacgtttgagaaaaacggcaagctgatgacgcgggcgttaaacccggatcgcgtctat
gaaacgccggatggcggaaagcttgtgctgccgggccgttcgcttatgttcgtgcgcaac
gtcgggcacttaatgacgaacaacgcgattttgcatgcgaatggcgaagaagtgcatgaa
gggatcatcgatgccgtcattacgagcttgatcatgaaacactcgctcatcggcaatacg
cgctatttgaactcgcgcaaaggctcgatttacatcgtcaagccgaaaatgcacggatcg
gcggaagtggcgtttgccaatgagctgtttgaccgcgtcgaagacatgctcggcctcgag
cggaacacgatcaaaatcggcgtcatggatgaagagcggcggacgtcgctcaacttgaaa
aactgcatctaccaagtgcgcgaccgcatcgtcttcatcaacaccggcttcctcgaccgg
acgggcgacgagattcatacatcgatggaagcagggccgatgctgcgcaaaaacgagatg
aaatcatcgacttggctgcaggcgtatgaaaaatcgaacgttgccgttgggcttgccgcc
ggcttccgcggccgggcgcaaatcggcaaagggatgtgggcgatgccggatttgatggcc
gaaatgctgaagcaaaaaggggcgcagctgaaagcgggcgccaacacggcatgggtgccg
tcaccgacggcggctacgctccatgcgcttcattaccatcaagtgaacgtcgcggctgtg
caaagcgagctggcgaacgagcgggccgactatcgcgacgacattttgcaaattccggtt
gtcgacaacccgcaatggacggcagaggaaattcaagaagaaatcgacaataactgccag
agcattttaggttatgtcgtccgctgggtcgatcaaggaatcggctgctcgaaagtgccg
gacatccataacattgggctgatggaagaccgggcgacgctccgcatttcgagccaaatt
ctcgccaactggctccaccatggcatttgcacgaaagagcaagtgcttgaagcgcttaag
cgaatggcgaaagtcgtcgacgagcaaaatgccggcgatccgaactatcggccgatggcg
ccgaactacgatgattcggtggcgttccaagcggcgtgcgacctcgtgttcctcggctat
gaacagccaaacggctataccgagccgattttgcaccgccgccgccaagaagcgaaagca
aaatttgcggctgtgcagccataa

DBGET integrated database retrieval system