KEGG   Geobacillus lituanicus: GLN3_09315Help
Entry
GLN3_09315        CDS       T05193                                 

Definition
(GenBank) capsular biosynthesis protein CpsI
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
gli  Geobacillus lituanicus
Pathway
gli00520  Amino sugar and nucleotide sugar metabolism
gli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GLN3_09315
Enzymes [BR:gli01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     GLN3_09315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 adh_short NAD_binding_10 NAD_binding_4 KR adh_short_C2 NmrA Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ASS87264
UniProt: A0A223DW89
Position
complement(1878545..1879549)
Genome map
AA seq 334 aa AA seqDB search
MIILVTGAAGFIGMHFAKRLLEEGYEVVGIDNLNDYYDPKLKEDRVLELKKYSRFTFVQL
DLADREGLFALFRNYAFTHVVNLAAQAGVRYSLQNPYAYVDSNLVGFVNILEACRHNPVK
HLIYASSSSVYGANAKMPFSTSDNVDHPVSLYAATKKANELMAHTYSHLYGIPTTGLRFF
TVYGPWGRPDMAYFSFTKSILEGKPIKVFNHGNMKRDFTYIDDIVEGMVRLLDRPPLPNE
QRDRFHPDPSSSYAPYKIYNIGNNQPVKLLDFIQTLESLLGVEAKKEFLPMQPGDVEATY
ADIDDLHQAVGFQPSTSIRDGLKKFVDWYKAYYQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatcattcttgtcacgggtgcagcggggttcattgggatgcactttgcgaaacggctt
ttagaagaaggatatgaagtggtcgggatcgataatttgaatgattattatgatcctaag
ttgaaagaggatcgtgtgttggaattaaagaagtatagccgttttacgtttgttcagctt
gatttggcggatcgggaggggctttttgcgctttttcgcaactacgcatttacgcatgtc
gtcaaccttgccgcgcaggctggggtacggtacagcttgcaaaatccttacgcttatgtc
gactcgaatctcgtcgggtttgtcaacatcttagaggcatgccgccataatcccgtcaaa
catttgatctatgcttcttcaagttcggtgtacggagcgaatgcgaaaatgccgttttcg
acaagcgacaatgtcgatcatcccgtgagtttatacgcggcaacgaaaaaggcgaatgaa
cttatggcgcatacatacagccatttgtacggcattccgacgaccgggcttcgttttttc
acggtgtacggaccatgggggcgcccggatatggcgtatttttcgtttaccaaaagcatt
ctggaaggaaagcccatcaaagtattcaaccatggaaatatgaagcgcgattttacgtat
atcgatgatattgtcgagggaatggtccgtctgttggatcgtcccccgcttcccaatgaa
cagagggatcgttttcatcctgatccgagctcaagttatgccccgtataagatttataat
atcggcaataaccaaccagtgaagctgcttgattttatccaaacattagaatcgctgctc
ggcgtggaggcgaaaaaagaatttttgcccatgcagccaggcgacgtggaagcgacgtat
gcggatattgatgacttgcatcaggccgtcggcttccagccttccacttccattcgggac
gggctcaagaagtttgtcgattggtataaagcgtactatcaataa

DBGET integrated database retrieval system