KEGG   Geobacillus lituanicus: GLN3_10385Help
Entry
GLN3_10385        CDS       T05193                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gli  Geobacillus lituanicus
Pathway
gli00450  Selenocompound metabolism
gli00970  Aminoacyl-tRNA biosynthesis
gli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gli00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    GLN3_10385
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GLN3_10385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gli01007]
    GLN3_10385
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gli03016]
    GLN3_10385
Enzymes [BR:gli01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     GLN3_10385
Amino acid related enzymes [BR:gli01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   GLN3_10385
Transfer RNA biogenesis [BR:gli03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GLN3_10385
 Prokaryotic type
   Other AARSs
    GLN3_10385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DUF4455 Use1 DNA_ligase_ZBD Zn-ribbon_8 Atrophin-1
Motif
Other DBs
NCBI-ProteinID: ASS87452
UniProt: A0A223DWT5
Position
2097413..2099362
Genome map
AA seq 649 aa AA seqDB search
MEKKTFYLTTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYDVMYLTGTDEHGQKIQRK
AQEKGVTPQQYVDDIVAGIQELWRKLDISYDDFIRTTQERHKKIVEKIFARLVEQGDIYL
GEYEGWYCTPCESFYTERQLVDGNCPDCGRPVEKVKEESYFFRMSKYVDRLLQYYEENPD
FIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALANYITALGY
GTDNDEKFRKYWPADVHLVGKEIVRFHTIYWPIMLMALGLPLPKKVFGHGWLLMKDGKMS
KSKGNVVDPVMIIDRYGLDALRYYLLREVPFGSDGVFTPEGFIERINYDLANDLGNLLHR
TVAMIEKYFGGAIPPYRGPKTPFDRDLSETAREVVRQYEEAMERMEFSVALSAVWQLIGR
TNKYIDETQPWVLAKEESKREELASVMAHLAESLRHTAVLLQPFLTRTPERIFTQLGISD
RSLKEWDSLYDFGLIPEGTNVQKGEPLFPRLDIGVEVEYIKAHMQGGKPAEAAKEEKQAA
RAEEISIDDFAKVDLRVAEVVHAERMKNADKLLKLQLDLGGEKRQVISGIAEFYKPEELI
GKKVICVANLKPAKLRGEWSEGMILAGGSGDGFSLATVDQHVPNGTKIK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaagacgttttatttgacgacgccgatttattacccaagcgacaaattgcat
attggccatgcttatacgaccgtggcgggggatgcgatggctcgctataagcggctgcgc
ggctatgatgtcatgtatttgaccggaacggacgaacatgggcaaaaaattcagcgcaag
gcgcaagaaaaaggggtcacgccgcagcaatatgtcgacgacattgtcgccggcatccaa
gagttgtggagaaaactggacatttcatacgacgattttatccggacgacacaggagcgg
cataaaaaaattgtcgaaaagattttcgcccgtcttgtcgaacaaggcgatatttattta
ggcgagtatgaaggctggtactgcacgccgtgcgaatcgttttacaccgaacggcagctt
gttgacggcaactgcccagactgcggccggcctgttgaaaaagtgaaagaagagtcgtac
tttttccggatgagcaaatacgtcgaccgcctgctgcaatattacgaagaaaatccagat
ttcatccagccggaatcgcggaaaaacgagatgatcaacaacttcatcaagccggggctc
gaggacttggctgtatcgcggacgacgtttgactggggcattaaagtgccaggtgacccg
aagcacgtcatttacgtctggatcgatgcgctggccaactacatcacagcgctcggctac
ggtacggacaacgatgaaaagtttcgcaaatattggccggcggatgtccatctcgtcggc
aaggagatcgtccgcttccatacgatttactggccgatcatgctgatggcgctcggcctg
ccgctgccgaaaaaagtgttcggacatggctggctgctgatgaaagatgggaaaatgtcg
aaatcgaaaggcaatgtcgtggatccggtgatgatcattgatcgttacgggcttgatgca
ctccgctactatttgctgcgggaagtgccgtttggctctgacggggtgtttacgccggaa
gggtttatcgagcgcatcaattacgatttggccaacgatttaggcaatttgttgcaccgg
accgtcgcgatgattgagaaatattttggcggcgcgattccgccgtaccgcggcccgaaa
acgccgtttgaccgagatctttccgaaacggcgcgcgaggttgtccgtcaatatgaagag
gcaatggagcggatggagttttccgttgccctctccgccgtttggcagctgattggccga
acgaacaaatatatcgacgaaacgcagccatgggtgttggcgaaagaggaaagcaaacgg
gaggaacttgcctctgtcatggcccatctagccgaatcgctccgccatacggcggtgttg
ctgcagccgtttttgacgcgcacgccggagcgcatcttcacccagctcggcatcagcgac
cgttcattgaaagagtgggacagcctgtacgatttcggccttattccggaagggacgaac
gtgcagaaaggggagccgctcttcccacgcttggatatcggcgttgaagtcgagtacatt
aaggcgcatatgcaaggcggcaaaccggcggaagcggccaaagaggaaaaacaagcggct
cgggcggaggaaatctccatcgacgactttgcgaaagtcgacttgcgcgtcgccgaagtc
gtgcacgccgagcgaatgaaaaacgccgacaagctgctgaagctccagcttgatctcggc
ggcgagaagcggcaagtgatttccggcatcgccgagttttacaagccagaggaactcatc
ggcaaaaaggtcatttgcgtcgccaacttaaaaccggccaagctgcgcggcgaatggtcg
gaaggaatgattttggccggcggcagcggcgacggcttttcgttggcaaccgtcgaccag
cacgtgccaaacggcacaaaaatcaaataa

DBGET integrated database retrieval system